Acanthamoeba castellanii: ACA1_335930 Help Entry ACA1_335930       CDS       T02667                                  Name (RefSeq) hypothetical protein   KO K12456   anaphase-promoting complex subunit 13 Organism acan  Acanthamoeba castellanii Pathway acan04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:acan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     ACA1_335930  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:acan04121]     ACA1_335930    03036 Chromosome and associated proteins [BR:acan03036]     ACA1_335930 Ubiquitin system [BR:acan04121]  Ubiquitin ligases (E3)   Multi subunit type E3    APC/C     Other subunits      ACA1_335930 Chromosome and associated proteins [BR:acan03036]  Eukaryotic type   Sister chromatid separation proteins    APC/C complex     ACA1_335930 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Apc13p Motif Other DBs NCBI-GeneID:  14919935 NCBI-ProteinID:  XP_004341201 UniProt:  L8H1M5 LinkDB All DBs Position Unknown AA seq 64 aa AA seqDB search MRVHHAKAALLLDLVDEAWAKDTLPDDLLMLPLEMQVDPETDEQKVPQEDEVWADLGLGE FTES NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgcgagtgcatcacgcgaaggcagcgctgctgctggacctcgtcgacgaggcgtgggcc aaagacaccctccccgatgacctcctgatgctgccgctggagatgcaagtcgaccctgag accgacgaacagaaggtcccgcaggaggacgaagtgtgggcagacctgggcctcggcgag ttcaccgagagctga

DBGET integrated database retrieval system