KEGG Orthology (KO) [BR:acar00001]
09140 Cellular Processes
09143 Cell growth and death
04110 Cell cycle
104519217 (YWHAG)
04114 Oocyte meiosis
104519217 (YWHAG)
09180 Brite Hierarchies
09181 Protein families: metabolism
01009 Protein phosphatases and associated proteins [BR:acar01009]
104519217 (YWHAG)
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:acar03400]
104519217 (YWHAG)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:acar04147]
104519217 (YWHAG)
Protein phosphatases and associated proteins [BR:acar01009]
Protein serine/threonine phosphatases
Phosphoprotein phosphatases (PPPs)
Protein phosphatase-1
PP1-interacting proteins (PIPs)
104519217 (YWHAG)
DNA repair and recombination proteins [BR:acar03400]
Eukaryotic type
Check point factors
Other check point factors
104519217 (YWHAG)
Exosome [BR:acar04147]
Exosomal proteins
Proteins found in most exosomes
104519217 (YWHAG)
167 aa
MVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATG
EKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTA
FDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN
