Actinoalloteichus caeruleus: ACOJVX_09095 Help Entry ACOJVX_09095      CDS       T11237                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism acau  Actinoalloteichus caeruleus Pathway acau00253   Tetracycline biosynthesis acau01056   Biosynthesis of type II polyketide backbone acau01100   Metabolic pathways acau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acau00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     ACOJVX_09095    00253 Tetracycline biosynthesis     ACOJVX_09095  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:acau01004]     ACOJVX_09095    01008 Polyketide biosynthesis proteins [BR:acau01008]     ACOJVX_09095 Lipid biosynthesis proteins [BR:acau01004]  Polyketide synthase   Component type    ACOJVX_09095 Polyketide biosynthesis proteins [BR:acau01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      ACOJVX_09095     Nonaketide PKS      ACOJVX_09095     Decaketide PKS      ACOJVX_09095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  XQU81622 LinkDB All DBs Position 2037713..2037976 Genome browser AA seq 87 aa AA seqDB search MSRFDLDELRQIMRSSAGVDEGVDLAGDIGDLEFGDLGYDSLAVLELVSHVQRAHGIVIP DEAVEEMPTPNRAVEYINRLAMEGNRS NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagcaggttcgacctcgacgaactccgccagatcatgcggtccagcgcgggggtggac gagggagtcgacctcgccggcgacatcggcgacctggagttcggcgacctgggctacgac tcgctcgccgtcctggaactggtcagccacgtccagcgcgcccacgggatcgtcatcccc gacgaggcggtggaggagatgccgaccccgaaccgggcagtggagtacatcaaccggctg gcgatggaagggaaccgttcctga

DBGET integrated database retrieval system