Acinetobacter pittii: BDGL_000089 Help Entry BDGL_000089       CDS       T01684                                  Symbol acpP Name (RefSeq) acyl carrier protein   KO K02078   acyl carrier protein Organism acc  Acinetobacter pittii Pathway acc00998   Biosynthesis of various antibiotics acc01100   Metabolic pathways acc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BDGL_000089 (acpP)    00074 Mycolic acid biosynthesis     BDGL_000089 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BDGL_000089 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1493 EutQ Motif Other DBs NCBI-GeneID:  11637242 NCBI-ProteinID:  YP_004994357 UniProt:  F0KEZ5 LinkDB All DBs Position 97093..97329 Genome browser AA seq 78 aa AA seqDB search MSDIEQRVKQAVAEQLGLKAEEIKNEASFMDDLGADSLDLVELVMSFENDFDITIPDEDS NEITTVQSAIDYVTKKLG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt gtgagcgatatcgaacaacgcgttaaacaagcggttgcagaacaacttggtcttaaagct gaagagattaaaaacgaagcatcttttatggatgacttaggtgctgactctttagattta gttgaacttgttatgtctttcgaaaacgacttcgacatcactatccctgatgaagattct aacgaaatcactacagttcaatctgcaattgactatgtaactaaaaaacttggttaa

DBGET integrated database retrieval system