Acinetobacter pittii: BDGL_003422 Help Entry BDGL_003422       CDS       T01684                                  Name (RefSeq) hypothetical protein   KO K02078   acyl carrier protein Organism acc  Acinetobacter pittii Pathway acc00998   Biosynthesis of various antibiotics acc01100   Metabolic pathways acc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BDGL_003422    00074 Mycolic acid biosynthesis     BDGL_003422   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BDGL_003422 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-GeneID:  11638091 NCBI-ProteinID:  YP_004997690 UniProt:  F0KMQ5 LinkDB All DBs Position 3675760..3676020 Genome browser AA seq 86 aa AA seqDB search MSNLADELKQMIIDVLALEDITIADIDTEAPLFGEGLGLDSIDALELGLALKKRYNIHLN AESDETKQHFKSIQSLVALVEAQQKS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcaatcttgctgatgaactaaagcaaatgattattgatgttctagcactagaagat attactattgccgatattgatacagaagctccattatttggagaaggtttaggattagac tcgattgatgcacttgagttgggactggctttgaaaaagcgttacaacattcatttaaat gcagaatcggatgaaaccaaacagcattttaagtcaatccagagcttggttgctttagtt gaagcacaacagaagtcataa

DBGET integrated database retrieval system