KEGG   Acinetobacter oleivorans: AOLE_00015
Entry
AOLE_00015        CDS       T01263                                 
Name
(GenBank) recombination protein F
  KO
K03629  DNA replication and repair protein RecF
Organism
acd  Acinetobacter oleivorans
Pathway
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AOLE_00015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_00015
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     AOLE_00015
SSDB
Motif
Pfam: SMC_N AAA_21 AAA_23 AAA_15 AAA_16 ABC_tran AAA_13 AAA_27 AAA_29 ATPase_2
Other DBs
NCBI-ProteinID: ADI88906
UniProt: D8JKL6
LinkDB
Position
2991..4073
AA seq 360 aa
MHLTRLNIERVRNLKTVALQGLQPFNIFYGANGSGKTSILEAIHLLATGRSFRTHIPKNY
IQYAAEDAIVFAQSSTEKIGMQKLASGEQLMKVNGDTVATQGQLAKLLPLQHLDPQSTDI
IDHGAKPRRQLLDWLMFHVEPEFYFAWQYYSRALKQRNTLLKTRRNLSLADLEPWNKMLS
DYGEILHSQRLGIVEQWNVFFQNDLSQLLPDLEIELEYSPGFHTEQGLMQDLLNQHQKDI
ERRYTEYGPHRADLRLKTPFGHADVVLSRGQKKLLIIALKLSQIAMLHASNKETVVLLDD
LTAELDLTAQQRLIERLSQLGSQVFMTTLDHASVKKHLHDLSISYQLFNVESGQVSLASP
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgcatcttacgcgcttaaacattgaacgtgtgcgtaatttaaaaacggttgcactccaa
gggttgcaaccgtttaatatattttatggcgctaatggttcagggaaaacctcaattctg
gaagcaattcatttgcttgcaactggacgatcgttccgcactcatattcctaaaaactat
attcagtatgctgccgaagatgcgattgtctttgcacagtctagtactgaaaaaattggc
atgcaaaagttagcctctggtgagcagttgatgaaggtcaatggcgataccgtagctacc
caaggccaacttgctaaattgcttcctttgcagcatcttgatccacaaagtaccgacatt
atcgaccatggtgcaaaaccacgacgccaacttttagattggctgatgttccacgtggaa
cctgaattttattttgcatggcaatactattcgcgggctttaaaacagcgaaatacgcta
cttaaaacccgaagaaatttgtcgttggctgatttagagccttggaacaaaatgctgagt
gattatggtgaaattttgcactctcagcgcttgggtattgtggaacaatggaatgtgttt
tttcaaaatgatttgagccaattactccctgatcttgaaattgaactggaatacagtcca
ggttttcatacagagcagggcctcatgcaagacctactaaatcaacaccaaaaagatatc
gaaagacggtataccgaatatggtcctcatcgtgcagatttacgcttaaaaaccccgttt
ggacatgctgatgtggttttatcaagaggtcagaaaaaactgctgattattgctttaaaa
ctgtcacaaattgcaatgttacatgcgagtaataaggaaactgtggtattattagatgat
ctgacagcagaattagacttaaccgcacaacaacgtttaattgaacgattaagccaactt
ggtagccaggtttttatgacaactttagatcatgcatcggtaaaaaaacacttacatgat
ctgtctatttcatatcaattattcaatgttgaatccggtcaagttagtcttgcttcacca
taa

DBGET integrated database retrieval system