KEGG   Acinetobacter oleivorans: AOLE_01585
Entry
AOLE_01585        CDS       T01263                                 
Symbol
rpoZ
Name
(GenBank) DNA-directed RNA polymerase subunit omega
  KO
K03060  DNA-directed RNA polymerase subunit omega [EC:2.7.7.6]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AOLE_01585 (rpoZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:acd03021]
    AOLE_01585 (rpoZ)
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_01585 (rpoZ)
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     AOLE_01585 (rpoZ)
Transcription machinery [BR:acd03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     AOLE_01585 (rpoZ)
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      AOLE_01585 (rpoZ)
SSDB
Motif
Pfam: RNA_pol_Rpb6
Other DBs
NCBI-ProteinID: ADI89220
UniProt: D8JMA2
LinkDB
Position
complement(352907..353185)
AA seq 92 aa
MARVTVEDCLDHVDNRFELVLVASKRARQLARQGMEPTVEWDNDKPTVVSLREIAAGHVT
KEILKQREQDYQTSSLDLALSTNSLNLEGFSF
NT seq 279 nt   +upstreamnt  +downstreamnt
atggcacgcgtcaccgttgaagattgtttagatcatgtagacaaccgttttgagcttgtg
ctcgttgcaagtaaacgtgctcgtcaattggcacgtcaaggcatggagccaactgtagaa
tgggataacgacaaaccgactgtagtttctttgcgtgaaatcgcggcagggcacgttacg
aaagaaattcttaagcaacgtgaacaagattatcaaacttctagtcttgatcttgctctt
tctacaaacagcttgaatttagaaggtttttctttctaa

DBGET integrated database retrieval system