KEGG   Acinetobacter oleivorans: AOLE_02015
Entry
AOLE_02015        CDS       T01263                                 
Name
(GenBank) ATP-dependent DNA helicase RecG
  KO
K03655  ATP-dependent DNA helicase RecG [EC:5.6.2.4]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AOLE_02015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_02015
Enzymes [BR:acd01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     AOLE_02015
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     AOLE_02015
SSDB
Motif
Pfam: RecG_wedge Helicase_C DEAD ResIII RecG_dom3_C tRNA_anti-codon AAA_30 SecA_DEAD SNF2-rel_dom DUF2075 DUF6033 Glyco_tran_WecG BrxC_BrxD AAA_16 PhoH ERCC3_RAD25_C TsaE
Other DBs
NCBI-ProteinID: ADI89306
UniProt: D8JMX4
LinkDB
Position
complement(437355..439400)
AA seq 681 aa
MTSVHQLQGVGSASAALLEKLNIFTTDDLLFHLPRDYEDRSTIIAMNQLVVGRSYLLEGE
VRSIDFPPGKRKSMAALVQDEFGKVTLRFYHIYKNLTDKIKPGHRLRIFGEVRVGARGLE
MYHPEIQLIHEHTPLPKTQLTAIYPSTDGLTQPKLREYVKQALKHHSDALPELLPKKYTN
GYALKEALYYIHEPPIDANMLQLAQGSHPAQQRLIFEELVAHQISLLNRRAYIRQIASPA
FSSSKILAKKLLEALPFQMTNAQKRVSKEILNDLKQHQPMLRLVQGDVGAGKTLVAAVAA
CHALEADWQVALMAPTEILAEQHYLNFKRWFEPLGITVAWLSGKQKGKARAQAEQQIKEG
HAELIVGTHALFQDNVGFAKLGLVIIDEQHRFGVDQRLALRNKGAEQFTPHQLVMTATPI
PRTLAMSAYGDLDTSIIDELPPGRTPIQTVTIPLDRREEVLQRIASNCRDGKQAYWVCTL
VEQSETLDAQAAEATYQEMKERFPELNIGLVHGKMKADEKQSVMQAFKNNELQLLIATTV
IEVGVDVPNSSIMVIENAERLGLSQLHQLRGRVGRGAQASFCVLLYKTPLSQNGQERLSI
LRESNDGFVIAEKDLELRGPGELLGTKQTGDMGFRVARLERDDHLLSQAHYVAQQVLKDY
PEQADALLKRWLPEAPRYAYV
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgacttcagtccatcagttacaaggcgttggatcggcttcagcagccctgctcgaaaaa
ctaaatatttttaccacagatgatttactgtttcatctgccacgtgattatgaagaccgc
agtacaattattgcaatgaatcaacttgtggttgggcgtagctatttactcgaaggtgag
gtcagatcaattgacttccctccgggaaaacgaaaatctatggcggccttggttcaagat
gaattcggtaaagttaccttacgcttttatcatatttataaaaacctgactgacaaaata
aaaccgggtcatcgcttacgtatttttggtgaagttcgtgtcggcgctcgcgggcttgag
atgtatcatcccgaaattcagctcattcatgaacatacacctctaccaaaaactcagctt
acagcaatttacccaagtacggatgggttaactcaacccaaactccgcgaatatgtaaaa
caagctttaaagcaccatagtgatgccttaccagagctgctcccaaaaaaatatactaat
ggctatgcgcttaaagaggctttgtattacattcatgagcctcctattgatgcgaatatg
ctccagttggcccaaggctcacacccagcccaacaacgacttatttttgaagaactagtt
gcgcaccaaattagtttacttaatcgccgtgcgtatattcgccaaattgcatccccagct
ttctcaagcagtaaaatattagctaaaaagcttttagaagccttaccttttcaaatgacc
aatgcacaaaaacgtgtatctaaagagattttgaacgacttaaaacaacaccaacctatg
ctgcgcctagtacaaggtgacgttggggctggaaaaaccttggttgcagctgtagctgct
tgtcatgctttagaagccgattggcaggttgcattaatggctcctaccgagattcttgca
gaacagcactatttgaattttaaacgttggtttgaaccattaggtattacagttgcttgg
ctatctggcaaacagaaaggtaaagcccgtgcccaagcagaacaacagattaaagaaggc
cacgcggaacttattgttggtacacatgccttatttcaagacaatgttggcttcgctaaa
ttagggctagtaatcattgatgaacaacatcgttttggtgtagaccaacgcttagcttta
cgtaataaaggtgctgagcaattcaccccacaccaactcgtcatgacagccactcctatt
ccaagaacactagcaatgagtgcctatggggacttagacacatcaattattgatgagttg
cctccaggccgtactccaattcaaaccgttacgattccacttgatcgtcgtgaagaggta
cttcaacggattgcttcgaattgtagagatgggaaacaggcatattgggtatgtacactg
gttgagcagtctgagactttagatgctcaagccgccgaagccacctaccaagaaatgaaa
gaacgctttcctgagcttaatattggcttagtgcatggcaaaatgaaagctgacgaaaaa
cagtcggtcatgcaagcgttcaaaaataatgagttacagcttcttatcgcaaccacggtc
attgaagttggtgtcgatgtccccaactcttctattatggtcattgaaaatgctgaacgc
ttaggactttctcagttacaccaattacggggtcgcgtaggtcgaggcgcacaggccagc
ttttgcgtccttttatacaaaacgcctctttctcaaaatgggcaagagagactttctatt
ttaagagaaagtaatgatggctttgtgattgcagaaaaagatcttgagttacgcggaccg
ggtgaattactaggtactaaacaaactggggatatgggttttagagttgctcgtttagag
cgagatgatcacttactcagtcaagctcattatgtagctcagcaagtcttaaaagattat
ccagaacaagcagatgcgctattaaaacgttggcttccggaagcgcctcgctacgcgtat
gtttag

DBGET integrated database retrieval system