KEGG   Acinetobacter oleivorans: AOLE_04385
Entry
AOLE_04385        CDS       T01263                                 
Symbol
ruvB
Name
(GenBank) Holliday junction DNA helicase RuvB
  KO
K03551  holliday junction DNA helicase RuvB [EC:5.6.2.4]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AOLE_04385 (ruvB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_04385 (ruvB)
Enzymes [BR:acd01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     AOLE_04385 (ruvB)
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AOLE_04385 (ruvB)
    RecFOR pathway proteins
     AOLE_04385 (ruvB)
SSDB
Motif
Pfam: RuvB_N AAA_lid_4 RuvB_C AAA AAA_5 AAA_22 Sigma54_activat AAA_3 Mg_chelatase TIP49 AAA_16 AAA_18 RNA_helicase AAA_14 Rad17 ABC_tran Sigma54_activ_2 AAA_17 NTPase_1 PaRep2b AAA_24 AAA_28 AAA_23 NACHT NB-ARC
Other DBs
NCBI-ProteinID: ADI89774
UniProt: D8JEC4
LinkDB
Position
complement(966816..967820)
AA seq 334 aa
MQDRLISGAEKPEDHFDRAIRPTSLADYIGQPVVREQMEIFIGAARGRGEALDHTLIFGP
PGLGKTTLANIIAREMGGNLKSTSGPVLERAGDLAAMLTNLEEGDVLFIDEIHRLSPVIE
EILYPAMEDYQLDIMIGEGPAARSIKLDLPPFTLVAATTRAGLLTSPLRDRFGIVQRLEF
YSVEDLTHIVSRSANLMNVPITVEGAEEVARRARGTPRIANRLLRRVRDYAQVKGTGEVT
HEMAQRALDMLNVDKAGLDTLDRRYLSMLLERFDGGPAGVEALAAAMAEDSGTLEDVIEP
YLIQQGYVMRTARGRIATNQSYLQFGMTPPEPKN
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgcaagaccgtttaatcagtggagcagaaaaaccagaagatcattttgatcgggcgatt
cgaccaacttcacttgccgactatattgggcaacctgtagtacgcgaacaaatggaaatt
ttcattggcgctgctcgcggtcgtggtgaagcactcgatcacacgctgatttttggtcca
cccggcttgggtaaaaccacacttgccaacattattgcgcgtgaaatgggcggtaatctt
aaatctacttcggggccagttttggagcgtgcgggtgacttagctgcaatgcttaccaac
cttgaagaaggcgatgtcttgttcattgacgaaattcaccgcctttctccagtgattgaa
gaaattctttatccagcgatggaagactaccaattagatattatgattggtgaagggcct
gctgctcgttcaattaaactcgatttacccccgtttacactggtcgcggctacaacacgt
gcaggtttgctcacctcacctctacgtgaccgtttcggtattgtgcaacgtcttgagttt
tactctgtagaagacctcactcatattgtgtcacgctctgcaaacttgatgaatgtaccc
attactgttgagggcgcagaagaagttgcacgccgtgcacgtggtacaccacgtattgcc
aatcgtttattacgacgtgttcgtgactatgcccaagtaaaaggcacaggcgaagtgacc
catgaaatggcacagcgtgcgcttgatatgctcaatgttgataaagctggcttagacacc
ctagatcgccgttatttgagcatgctgctagagcgttttgatggcggccctgctggagtc
gaagcgcttgcagcagcaatggctgaagatagcggcacacttgaagatgtgattgaaccg
tatttaattcaacaaggttatgtgatgcgtaccgcgcgaggtcgcattgcaacaaaccaa
tcttatttacagtttggaatgacaccacctgagcctaaaaactaa

DBGET integrated database retrieval system