KEGG   Acinetobacter oleivorans: AOLE_06955
Entry
AOLE_06955        CDS       T01263                                 
Name
(GenBank) DNA polymerase III, tau and gamma subunits
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03030  DNA replication
acd03430  Mismatch repair
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOLE_06955
   03430 Mismatch repair
    AOLE_06955
   03440 Homologous recombination
    AOLE_06955
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_06955
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_06955
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AOLE_06955
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AOLE_06955
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AOLE_06955
SSDB
Motif
Pfam: DNA_pol3_delta2 DNA_pol3_gamma3 AAA Trypan_PARP RuvB_N AAA_5 AAA_19 AAA_30 AAA_16 AAA_18 DNA_pol3_tau_5 AAA_22 AAA_14 TsaE Mg_chelatase TonB_N AAA_24 AAA_assoc_2 DNA_pol3_delta AAA_7 Rad17 SKI Herpes_Helicase AAA_28
Other DBs
NCBI-ProteinID: ADI90284
UniProt: D8JHB4
LinkDB
Position
1512688..1514841
AA seq 717 aa
MYQVLARKYRPRNFNELVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKC
LNCETGVTSTPCEVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFK
VYLIDEVHMLSTHSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVD
EITRHLGAILEKEQINADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGSVHHQDVKEML
GLIDRTIIYDLILAIHQNQREKVSQLLLQFRHQALDVSLVLDQLISTLHELAILQYLPDL
SLKYSDEINRKIMQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRLLAFRP
LAPNEILVSEPVQQNGQAVMNHQVQQQVQDIAPVSAVQPVEVISQPVMVEPEPEPEPEPE
PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQSNQDLMVFDPNHHELIGLESAVVHET
VSVLEEDFIPLPEQKFVQVQAETQAKQIEPESAFSAEPQGLFETSSAEFSLDQDAPITPD
LSSEPVIEQQSFVQAEVMVQTETVAVVKESSETDNGQLMPQDILKLAPQVLEGEWSLEKW
EYWFRNSQLSPAVQELAQHGVMTGEIGGNTIFHIPQEYENMLTQLQQGLIDALNEQWPNT
QFTVEYGALNTSTPYTIQSARKEKAFHRAAELLQQQPVIKSLIETFDGELQNIQLKP
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgtatcaagtacttgctagaaaataccgtccacgtaatttcaatgagttagtggggcaa
aaccatgtttctcgtgcattaagtagtgcattggaacgcggtcgtctgcaccatgcttat
ttatttacaggaacgcgtggtgtaggtaaaactacaattgcacgtattttagccaagtgt
ttgaactgcgaaacaggtgtgacttcaacgccgtgtgaagtctgtgcaacgtgtaaagcg
gtaaatgaaggtcgctttattgacctgatcgaaatcgatgctgcttcaagaacaaaagta
gaagatacacgtgaacttttagacaacgttccttatgcgccaacgcaaggtcgttttaaa
gtttacctgattgacgaagtgcatatgctttctacgcattcttttaatgcgttattaaaa
acactagaagaaccaccagaacacgttaagtttctgtttgctacgactgacccacaaaag
ttaccaattacggtcatttcacgttgtttgcaatttactctacgacctttagctgtcgat
gaaattaccaggcaccttggcgctattcttgaaaaagagcaaattaatgccgatcaggat
gcaatttggcaaattgctgaatctgctcaaggttcattacgtgatgcattatctttaact
gaccaagccattgcttatggtcaaggttctgtacatcatcaagatgttaaagaaatgctt
ggcttgattgatcgtacaattatttatgatttgattttagcgattcatcagaaccaacgt
gagaaagttagtcagcttttattgcaatttagacatcaagcgttagatgtttcactggtg
cttgatcagttgatttcgacattgcatgaattggcaattttgcaatatctacctgatttg
agtttgaaatatagcgatgaaatcaatcgcaaaatcatgcaactgtctaagctgatttct
gctcaagatttgcagctttattaccaaatcgcatgtaaaggtcgttcagacttgcaactt
gccgtgacgcaagagcaaggttttgaaatgtgcgttttacgtttattagcattccgtcct
ttagcgccaaatgaaattttagtatcagagcctgttcaacaaaatggacaagcagtgatg
aatcaccaagtacagcaacaagttcaagatattgctcctgtaagtgctgttcagcctgtt
gaagttattagtcaacccgttatggttgaacctgaacctgaacctgaacctgaacctgaa
cctgaacctgaacctgaacctgaacctgaacctgaacctgaacctgaacctgaacctgaa
cctgaacctgaacctgaacctgaacctgaacctgaacctcagtctaatcaggatttaatg
gtatttgatccaaatcatcatgagttgattggacttgagtcagcagttgttcacgagact
gttagtgttctggaagaagatttcattccgttaccagaacaaaagtttgtacaagttcag
gcagaaacccaagcaaaacaaattgaaccagaatcagctttttctgctgagcctcaaggt
ttgtttgagacatctagcgctgaattttcccttgatcaagatgcgcctataactcctgat
ttgtcttctgaacctgttattgaacaacagtcatttgtacaagccgaagtaatggttcaa
acagaaacagttgcagttgtgaaagagtctagcgaaactgataacgggcagctgatgcct
caagatatcttgaagctggctcctcaagttttagaaggtgagtggtcacttgaaaagtgg
gaatattggtttagaaatagtcaactttcacccgctgttcaagaacttgcgcagcatggt
gtgatgactggtgaaattggcggcaatactattttccatattcctcaagaatatgaaaat
atgctgacccaattgcagcaaggccttattgatgcattaaatgagcaatggccgaatact
caatttacagttgaatatggtgctttgaatacatctacaccatataccattcaaagtgcg
cgtaaagaaaaagcttttcaccgagcagccgagctgttacagcaacagccagttattaag
agtctcatagaaacttttgatggcgaactacaaaatattcaattaaagccttaa

DBGET integrated database retrieval system