KEGG   Acinetobacter oleivorans: AOLE_11360
Entry
AOLE_11360        CDS       T01263                                 
Name
(GenBank) DNA polymerase III DnaE
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03030  DNA replication
acd03430  Mismatch repair
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOLE_11360
   03430 Mismatch repair
    AOLE_11360
   03440 Homologous recombination
    AOLE_11360
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_11360
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_11360
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AOLE_11360
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AOLE_11360
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AOLE_11360
SSDB
Motif
Pfam: DNA_pol3_alpha DNA_pol3_finger HHH_6 PHP tRNA_anti-codon
Other DBs
NCBI-ProteinID: ADI91161
UniProt: D8JLC1
LinkDB
Position
2436781..2440344
AA seq 1187 aa
MQFVHLGIYTEFSITESIVRIPDLVNAAVKDQMPALALTDLSNLHAAVKFYNACLKKGIK
PLLGSTIRLDDAQHRATLLAMSDVGWKSLTEIVSRGFIEGQQLSIPCVKKEWVLEQHQDI
IVLLGQHSDVGQMLCSSNPQKAAPLLEAWLEKFGNRVYLALTRTDRPGEEDFIQEAAKLA
AQYNVGVVAHNDVHFVEKEDFEAHEARVCIADGYVLADNRRPRIYSPEQHFKTSDEMIEL
FSDIPSAIENTYHIAKRCNVKLQLGTYFLPDYPIPDGFTIDTYFEHLSKVGLEERLNYLY
PVEKRGEDWPEIRKPYDERIDYEVGIILKMGFPGYFLIVMDFIQWAKNNGVPVGPGRGSG
AGSLVAYSLKITDLDPLRYDLLFERFLNPERVSMPDFDVDFCIAGRDRVIDYVSRTYGRE
AVSQIATFGTMAAKGAIRDVARVLGKSYGLADRISKMVPTKPLGVDLATAIDMEPQLKDI
VTNPSNPDNDDASEIWEMALKLEGVTRNTGKHAGGVVIAPGKITDFSAVLCDADGTNRVA
QYDKDDVEAAGLVKFDFLGLRNLTVIEDAIQNINKNRDSNDQLNILHVPLDDAKAYSVFA
DANTTAVFQFESVGMKRMLKEARPSKFEEIIAFVSLYRPGPMDLIPDFIHRMHGGDFEYL
HPLLEGVLEPTYGIMVYQEQVMQTAQICAGYTLGGADLLRRAMGKKKPEEMVKQRQIFLE
GAAEKGIDESTANHIFDYMEKFAGYGFNKSHAAAYALVAYHTAWLKAHYPAEFMAAVMTS
EMQNTDSVVFLIDDCRNNNLEVLPPSVNMSTYHFHASNDKTIVYGLGAIKGVGEQAMQSV
IDSRRQFGPYTDLFDFCHRIDLKKINKRTLEALIRAGALDCLGIERASLMAQLPEAVQAA
EQARSNRESGIMDLFGEVEEVQRKPAKPVKPWSDEVRLKGEKDTLGLYLTGHPIDVYRQE
LKAFIPVKLNEITATRRGVTTVYAGLVIDVANFPNRVVIVLDDGTARIEVSCNHERFQRF
KDIVQVERVVVFEGEIYEREGFDRPMGRLTKAFTLNEIRQKRANSIQIKLTEEFMQPTLA
KDLQNMILPFCNVDMHQHISLQLQIDQSYAQAELQFGPQWKVAPLDELLAKLRDYFGKDN
IYIEYQVKSKAAKAADPVRPHAVAPPPAGMSMDDALDLYQSEVSQYS
NT seq 3564 nt   +upstreamnt  +downstreamnt
atgcagtttgttcatctaggtatttatacagaattttcgattacagagtcgatagttcgc
atacctgacttggtcaatgctgcggttaaagaccaaatgcctgcgttggcattaactgac
ctctctaacctccatgcggcggtaaaattttataatgcttgtttaaaaaaaggcattaag
cctcttttaggtagtacgattcgccttgatgatgctcaacaccgtgcaacattacttgca
atgagtgatgttggatggaaaagtctcaccgaaatcgtttcacgcggttttattgaagga
caacagctcagtattccatgtgtaaaaaaagaatgggtacttgaacagcatcaagatatt
atcgttttacttggccagcatagtgatgttggtcagatgctttgttcatctaacccacaa
aaagcagctccccttttagaagcatggctcgaaaagtttggtaaccgtgtttatcttgct
ttaacacgtaccgaccgtcctggtgaagaagactttattcaagaagcagctaaacttgct
gcacaatataatgttggtgtagttgcacataatgatgtgcactttgtagaaaaagaagat
ttcgaagcacacgaagcacgtgtttgtatcgctgatggttatgtactcgcagataatcgt
cgtccacgcatatatagtcctgagcagcactttaaaacctcagatgaaatgatcgaattg
ttttccgatattcctagcgctatcgagaacacctatcatattgctaaacgctgtaacgtt
aaactgcaactcggaacttactttttacctgactatccaattccagatggttttaccatc
gatacttattttgaacatttatctaaagtaggcttggaagagcgcttaaattatctttac
cctgttgaaaaacgtggtgaagattggccagagattcgtaagccttacgatgaacgaatt
gattatgaagtcggtattatcctgaagatgggtttccccggctacttcctcatcgtcatg
gacttcattcaatgggcaaaaaataatggtgtgccagttgggccgggtcgtggttcaggt
gcaggttcattagtcgcatacagcttaaaaattacagaccttgacccacttcgttacgat
ctgctcttcgaacgtttcttgaacccagaacgtgtatcgatgcctgactttgacgtcgat
ttctgtattgctggacgtgaccgcgttattgattacgtatcgcgtacttatggtcgtgaa
gccgtttcacaaattgcaactttcggaaccatggcagcaaaaggtgcaatccgtgacgtt
gcgcgtgtattgggtaaatcttacggtttagctgaccgtatttcaaaaatggtgcctacc
aaaccactcggtgtggatttagctaccgctattgatatggaaccacagcttaaagatatt
gtgaccaacccctctaacccagataacgacgatgcaagtgaaatctgggaaatggcatta
aaattagaaggtgtaacccgaaatacgggtaaacatgccggaggtgtagttattgcacca
ggtaaaattaccgatttctcggctgtactttgtgatgcagacggaacaaaccgcgttgct
caatatgataaagacgatgtagaagcagcaggtctggtcaagttcgacttcttgggttta
cgtaacttaaccgttattgaagacgcgattcaaaatattaataaaaaccgcgacagtaat
gatcaactcaatatcctgcatgttcctctagacgacgctaaagcttattctgtctttgcc
gatgcaaatacaacagcggtattccagtttgaatccgtcggcatgaaacggatgcttaaa
gaagcacgtccaagcaaatttgaagaaattattgcattcgtatccttgtatcgtccgggt
ccaatggacctgattcctgactttattcaccgtatgcatggtggagattttgaatatctc
catcctcttttagaaggtgtattagaaccaacttacggaattatggtttatcaggaacag
gtaatgcagactgcacagatttgtgcaggttataccttaggtggcgcagacttactacgc
cgtgcaatgggtaaaaagaaacctgaggaaatggtcaaacagcgccaaatcttcttagaa
ggtgctgctgaaaaagggattgacgaaagcacagcaaaccatatctttgactatatggaa
aagtttgcaggctatggttttaacaaatctcacgcggctgcttatgccctagttgcctac
catactgcatggttaaaagctcattaccctgctgagtttatggcagcggtaatgacatcc
gaaatgcaaaacacggacagtgttgtatttttgattgatgactgtcgaaacaataatctt
gaagtcttaccaccatcagtcaacatgtcgacttatcacttccatgcaagtaacgataaa
acgattgtttatggtttaggtgcaattaagggcgtcggcgaacaagcaatgcagtcagtt
attgactctcgtcgacaatttggtccttatacagatctattcgatttttgccatcgtatt
gatttgaagaaaatcaataagcgtactcttgaagctttaattcgcgcgggtgcactcgat
tgcttaggaattgaacgtgcaagcttaatggctcaattgcctgaagctgttcaagccgct
gaacaagctcgaagtaaccgtgaaagcggaattatggatttatttggtgaggttgaagaa
gttcagcgtaagccagctaaaccagtaaaaccatggagtgacgaagttcgtctcaaaggc
gaaaaagatacgcttggtttatatttaaccggtcatccaattgatgtttaccgacaagaa
ctcaaagcttttattcctgtaaaactaaacgaaattactgcgacgcgtcgtggtgttaca
acggtttatgcaggtttggtcattgatgtcgcaaacttcccgaaccgtgtggttattgta
ctagatgatggtacggcacgtattgaagtcagctgtaaccatgagcgtttccaacgtttt
aaagatattgtgcaagttgaacgtgttgtcgttttcgaaggcgaaatctatgagcgagaa
ggctttgatcgtccaatgggacgtttaaccaaggctttcacgttaaatgaaataagacaa
aaacgtgctaacagtattcaaatcaaattgacagaagagttcatgcagccaacactggca
aaagatctgcaaaacatgatcttgccattttgcaatgtagatatgcatcaacatatctct
ctacagttacagattgatcaatcctatgctcaagccgaacttcagtttggtccgcaatgg
aaagtcgctcctctagatgaattacttgctaaactcagagattattttggtaaagataat
atttatattgaatatcaagtaaagtcgaaagcagctaaagcagcagaccctgttcgtcca
catgctgttgcccctcctcctgcgggtatgtctatggacgatgcattggatttataccaa
agcgaagtttctcaatattcgtaa

DBGET integrated database retrieval system