KEGG   Acinetobacter oleivorans: AOLE_15495
Entry
AOLE_15495        CDS       T01263                                 
Name
(GenBank) DNA primase
  KO
K02316  DNA primase [EC:2.7.7.101]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03030  DNA replication
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOLE_15495
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_15495
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.101  DNA primase DnaG
     AOLE_15495
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    AOLE_15495
SSDB
Motif
Pfam: zf-CHC2 Toprim_N Toprim_4 Toprim_2 Toprim Toprim_3 DnaB_bind DEC-1_N
Other DBs
NCBI-ProteinID: ADI91986
UniProt: D8JF90
LinkDB
Position
3298477..3300351
AA seq 624 aa
MAIPQHTIDQILDRTDIVDLIGQRVKLKKTGRTYSGCCPFHQEKTPSFHVYRDKQYYHCF
GCQANGNAIRFLMDIDNRNFIDVMKELSSSAGVELPKDNTENKKLSYTRQVTKPPVAKAN
TAEPVTPTPQQPTDESYNTLEPVFFDDPFAQFEQPFSFDEPVQEGNLYDLLENVAQFYEH
QLPNSQKAKNYFKQRGLTNQTIQFWRLGYAPEDWQHLEKAFPYDIDGLKQLGLIRSSDSG
RDFDLLRDRVIFPIRDPKGRVVGFGGRALNDEIKPKYINSPDSEVFHKNQLLYGLYEGRK
LKSSDWLMVEGYMDVIALQQYGITGAVATLGTASNTEHLNILFKQNSRITIAFDGDAAGQ
KAARRTLEIALPLLNDGRELKFFVLPNDHDPDSLIRREGLENFQKLLQQAPLLSDFVFAH
LTGQHDISTPEGKSLVMGELRELTELLPKQGSFRYLLNQSFREKLGLGKRFTPQVSHDAS
LSFNIQTKDEDFAVAILMHHPFLYIHFEGLRAYIPQDELLAKILATLNRIFDELPDDQEL
ATYYVLGACSSYCHEIADIMQRTNIQALTQAPEVADKLAQEYALGLKERYLRQKLKSPIS
LIESRNLRQQLNELTKQISLRLLS
NT seq 1875 nt   +upstreamnt  +downstreamnt
atggcaattccacaacatacgattgatcagattttagatcgcacagatattgtcgatctg
attggtcaacgtgtgaaactgaaaaagacgggacgtacatattccggctgttgccctttt
catcaagaaaaaacgccatcgttccatgtctatcgcgacaagcagtattatcactgcttt
ggttgtcaggctaacgggaacgcgatccgatttctcatggacatcgataaccgaaatttt
atagatgtcatgaaggagctatcgagtagcgctggagtcgaactaccgaaagataatact
gaaaataaaaagctgtcttatacccgtcaggttacgaaaccaccagttgctaaagcaaat
acggcggagcctgtaactccaactccacaacaaccaactgatgaaagctataacacgctt
gaacctgtattttttgatgatccatttgctcagttcgagcagccttttagttttgatgaa
ccagttcaagaaggtaatttatatgacttactggaaaatgttgctcagttctatgagcac
caattacctaatagtcaaaaggcaaaaaactactttaaacaacgtggcttaactaatcag
actattcagttttggcgcttgggctatgcaccagaagactggcaacacttagaaaaagct
tttccttatgacattgatggtttaaaacaacttggacttattcgttcaagcgatagtggc
cgtgattttgacttattacgtgaccgtgtcattttcccgattcgagacccaaaaggtcgc
gtcgttggttttggtggacgtgccttaaatgatgaaatcaaacccaaatatatcaactca
cctgactcagaagtctttcacaagaatcagctactttatgggctttatgaaggcagaaaa
cttaagtctagcgactggttgatggttgaaggctacatggatgtcattgcgcttcagcaa
tatggcattacaggggctgtcgcaactttagggactgcaagtaatacagaacatcttaat
attttatttaaacaaaatagccgaattaccattgcttttgacggtgatgctgcgggtcaa
aaagcagcacgcagaacgctagaaattgctttaccacttctcaatgatggccgtgaactc
aaatttttcgttctaccaaatgaccacgatccggactctcttattcgtcgtgaagggctt
gaaaatttccagaaactattacaacaggcccctcttttgtctgattttgtgtttgcccat
ttaacaggtcaacacgacattagcactcctgaaggcaaaagcttggtcatgggtgaactc
agggaactaactgaactattacccaaacagggttctttccgttatttacttaatcaatct
ttccgtgaaaaactcggactaggtaaacgttttaccccacaagttagtcacgatgcatcg
ttatcatttaatattcaaacgaaagatgaagactttgctgtcgcaattttgatgcaccat
ccattcctttatattcattttgaaggattacgtgcctatattccccaagatgagttattg
gctaaaatattagcaactttaaaccgtatatttgatgagttgcctgatgaccaagagcta
gcgacttattatgttttgggtgcatgcagcagttattgccatgaaattgcagatattatg
caaaggaccaatatccaagcattaactcaagcacctgaagtggctgacaagttagctcaa
gaatatgcgttaggcttaaaagaaagatatttacgtcaaaagcttaagtcaccgatttct
ctgattgaatcaagaaatctaaggcaacaactcaatgaactaacaaaacaaattagctta
agactgttgtcttaa

DBGET integrated database retrieval system