KEGG   Acinetobacter oleivorans: AOLE_16400
Entry
AOLE_16400        CDS       T01263                                 
Name
(GenBank) DNA polymerase I(POL I)
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03030  DNA replication
acd03410  Base excision repair
acd03420  Nucleotide excision repair
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOLE_16400
   03410 Base excision repair
    AOLE_16400
   03420 Nucleotide excision repair
    AOLE_16400
   03440 Homologous recombination
    AOLE_16400
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_16400
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_16400
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AOLE_16400
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     AOLE_16400
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     AOLE_16400
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     AOLE_16400
SSDB
Motif
Pfam: DNA_pol_A 5_3_exonuc_N DNA_pol_A_exo1 5_3_exonuc HHH_5 HHH_2 HHH Transposase_20
Other DBs
NCBI-ProteinID: ADI92167
UniProt: D8JG49
LinkDB
Position
3493162..3495933
AA seq 923 aa
MPPFVLVDGSYFLFRAYHALPPLTTSTGLHTNAIRGAISAIQKLMRRMQPTHMAVIFDTP
EPTFRHKLSPIYKGDRPTMPEELSQQIPYLHALIKAQGIPLYSLPGAEADDIIGTLAKRA
VLEGHHVLISTGDKDMAQLVNDHVKLEDSFKDRVMDTDGVFEKFGVWPNQIIDYLTLMGD
ASDGIMGVPGVGAKTAAKLLTEYGTLENIIANADQLKGKISQNIKDNLDNIKLDHQLASI
VCDLPLELDWHELKLTDPNVDALRNLYTELEFRNQLQSLDHPNNPNSSTYKQQVSQVVVQ
DEVKPADAIETEDQASLTSQDDQLGTANYHTVLTQEAWDQLLQRMQNADHFAIDTETTSL
DYRIAEMVGFSIAFDAQDAYYVPLAHNYENAPQQLDREQILAQIKPVLENEAVKKIGHHL
KYDAHIFANHGIELKGWYFDSMLASYVLNAAATRHGMDDVARVYLSHLTTTFEQIAGKGA
KQKTFNQIEIEVAAHYAAEDAHVTYRLYEVLSNKLKPFPELENILYNIEMPVARILSGME
EDGIRLDHAFLDKLSVEFAKTMEGLENQAMEIADETFNIASPKQVGEILFDKLGIKGGKK
TATGQYSTSESVLEKIEHPLAEIILEHRGLAKLKSTYTDRLVEQSHNDTHRVHTSYHQAL
TATGRLSSSDPNLQNIPIRRQIGRQIRKAFIAPEGRVLLAADYSQIELRLMAHFSQDDAL
VHAFQHGQDVHRRTAAEVLGIAIEDVTNDQRRQAKAVNFGLLYGMSEFGLIRQLGFTRQE
SQNYIKQYFQRYPGIYEYMQRTRQVASEQGFVETILGRRLYTPDIDARNVMVRKAAERAA
INAPLQGSAADIIKIAMIEVDKILPKDQAKLLLQVHDELVFEADQNIAEELSKQIAKVME
SVVEISVPLVVEVGQGKNWDDAH
NT seq 2772 nt   +upstreamnt  +downstreamnt
atgccaccatttgtcttggttgatgggtcctattttttatttcgtgcatatcatgcatta
ccaccattgacgacctctacagggttacataccaatgcaatacgtggagcaatttctgcg
attcaaaaacttatgcgtcgtatgcaaccgacgcatatggccgtaatttttgatacgcct
gagccaactttccgccataagctttcacctatttataaaggtgatcgcccaaccatgcct
gaagagttatctcaacagattccatatttacatgcattaattaaagctcaaggcattcct
ttatatagtcttccgggtgcagaagcagatgacattatcggaacacttgctaaacgtgcc
gtgcttgaaggccatcatgtacttatctcaactggagataaagacatggctcagctcgtc
aatgatcatgtcaaacttgaagatagctttaaagatcgcgtaatggacaccgacggtgta
tttgaaaaatttggcgtttggccaaatcagattatcgactacttaacccttatgggcgat
gcgtctgatggtatcatgggtgtgcctggcgtaggtgcaaaaacagcagctaagttactg
actgaatatggcactttagagaatatcattgccaatgctgatcaacttaaaggcaagatt
agccaaaatattaaagataatttagacaatattaagcttgatcaccagttagctagcatt
gtctgtgatcttcctttagaactcgactggcatgaattaaagcttaccgatccaaatgtt
gatgctttacgtaacttatatactgagcttgagtttagaaatcagttacagtcacttgat
catccgaataatccaaacagctctacttataaacaacaagtttcacaagtagtcgttcaa
gatgaagttaaaccggctgacgctatagaaaccgaagatcaagcaagcttaactagtcaa
gatgaccaacttggaactgcaaattatcataccgttttaactcaagaagcgtgggatcaa
ctcttgcaacgcatgcaaaatgctgatcattttgccattgatacagaaaccacaagtctt
gattatcgtattgccgagatggttggtttttcaatcgcctttgatgctcaagacgcttat
tatgttcctttagcacataattatgaaaatgcaccgcagcaactggaccgtgaacaaatt
ctggctcaaattaagcctgtattagaaaatgaagcggttaaaaaaatcggtcatcatctt
aaatatgatgcccatatctttgctaatcatggaattgagttaaaaggctggtatttcgat
agcatgctggcatcgtatgtactaaatgcagcagcgactcgtcatggcatggatgatgta
gctcgtgtctacttaagccacttaacgaccacctttgaacaaattgctggtaagggtgca
aagcagaaaacttttaatcaaattgagattgaagttgctgctcactatgcagcagaagat
gctcatgtgacctatcgtttgtatgaagtactttcaaacaaacttaagccatttcctgag
ttagaaaatattttatataacatcgaaatgccggttgcccgaattttgtcaggcatggaa
gaagatggtattcgtttagatcatgctttcttagataaattaagcgttgagtttgcaaaa
accatggaaggccttgaaaatcaggctatggaaattgcagatgaaacttttaatatcgct
tcacctaagcaagtaggcgaaatcctatttgataaattaggaatcaaaggcggtaaaaaa
actgcaactggacaatacagcaccagtgaaagtgttttagaaaaaattgaacatccttta
gcggaaattattctagagcatcgtggtttggcaaagctaaaaagtacctatacggaccgt
ctagtagagcaatctcataacgacacgcaccgtgtgcatacgagctatcatcaagcactc
acagcgacaggtcgcctctcctcttctgatcctaacttacaaaatattccaattcgtaga
caaattggccgtcagattcgtaaagcattcattgcacccgaaggccgagttttactagca
gccgattactcgcaaattgaactacgtttaatggctcatttttctcaggatgatgcttta
gtacatgcattccagcacggacaagacgttcaccgccgtaccgctgcagaagtattgggc
attgcaattgaagatgtgaccaatgatcaacgtcgccaagctaaggcagtaaactttggt
ctactgtatggtatgtctgagtttggcttgattcgccagttaggtttcacacgtcaagaa
tcacaaaattatattaaacaatatttccaacgctatcctggcatctatgaatatatgcaa
cgcacgcgtcaagttgcatcagagcaaggttttgttgaaactattttaggccgtcgtcta
tatacaccagatattgatgcacgaaatgtgatggtgcgtaaggctgccgaacgtgctgca
atcaatgcacctttacaaggtagtgcagctgatattattaaaattgctatgattgaagtc
gataaaatcttgccaaaagatcaagccaaattactacttcaagtacacgatgaattagtt
tttgaagccgatcaaaacattgctgaagaactttccaaacaaatcgcaaaagtcatggaa
tctgttgtagaaatttctgtgcctttagtggttgaagtaggacaaggaaaaaactgggat
gacgcccattaa

DBGET integrated database retrieval system