KEGG   Acinetobacter oleivorans: AOLE_16740
Entry
AOLE_16740        CDS       T01263                                 
Name
(GenBank) DNA polymerase III, delta subunit
  KO
K02340  DNA polymerase III subunit delta [EC:2.7.7.7]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03030  DNA replication
acd03430  Mismatch repair
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOLE_16740
   03430 Mismatch repair
    AOLE_16740
   03440 Homologous recombination
    AOLE_16740
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_16740
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_16740
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AOLE_16740
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AOLE_16740
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AOLE_16740
SSDB
Motif
Pfam: DNA_pol3_delta DNA_pol3_delt_C
Other DBs
NCBI-ProteinID: ADI92235
UniProt: D8JGB7
LinkDB
Position
3568831..3569820
AA seq 329 aa
MKIDYLQALKRTPEARGAWILHGQEPLLEQNLLDAFRKSWQQQEVERQRYDISSVSDWKN
VFNALNSLSLFSQQLAIEVHGNIKPDANGLKQLKSYIQHNEHNLLLIVLPKQDSSSLKSA
FFQVVEANGVVVALTANYPQDRQRILSAEADKLEIQLDNDAWQWLMQHHEHNLLAAKNSL
MRVRDTFPDQQLIQIEQLYACLQDQSRYTTYDLSDALLEGNLGQSIKIFQYLIAAGEPDS
LILWTLSKEMRLLMQLFEQPHNALQLGIWKTKVSLYQQALRRLNPQQFLGWSTLLLQIDA
AIKGMSNENAEHLMQQAIAELCGKTLFIQ
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaaaattgattatttacaagccttaaaacgtactccggaagctcggggtgcgtggatt
ttacatgggcaagagcctttattagaacaaaatttattagatgcctttcgaaaaagctgg
caacaacaagaagttgaaagacagcgctatgatattagtagcgtaagcgactggaaaaat
gtctttaacgcacttaatagcttatctttattttctcagcagcttgctattgaagtacac
ggcaatataaaacctgatgcgaatggcttaaaacaactcaaaagctatatacaacataat
gaacataacctgctattaattgttttacctaaacaagatagtagtagcttaaaatctgct
tttttccaagttgttgaagcaaatggggttgtagttgccctcacggcaaattacccacaa
gatcgccaaagaattttatctgctgaagcagataaacttgaaattcaactcgacaatgat
gcttggcagtggttaatgcaacatcatgagcacaatttgcttgcagctaaaaatagcttg
atgcgtgtaagagacacatttccagaccaacaactcattcaaattgaacaactatatgcg
tgcctacaagatcaatcacgctataccacctatgatttaagtgatgcattattagaaggc
aaccttggccaatctattaagatttttcaatatttaattgcagcaggcgaacccgatagt
ctgattttatggactttaagtaaagaaatgcgtttgttgatgcaattgtttgaacaaccc
cataatgccttacagcttggtatctggaaaacaaaagtcagcttatatcaacaagcatta
agaagactaaatccacaacagtttctaggctggtctacccttctattgcaaatcgatgca
gcaattaaaggaatgtcgaacgaaaatgcagaacatttaatgcagcaagcgattgctgaa
ttatgtggaaaaacattatttatacagtaa

DBGET integrated database retrieval system