KEGG   Acetobacter vaccinii: FLP30_05395
Entry
FLP30_05395       CDS       T07989                                 
Symbol
accC
Name
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
acek  Acetobacter vaccinii
Pathway
acek00061  Fatty acid biosynthesis
acek00620  Pyruvate metabolism
acek00640  Propanoate metabolism
acek00720  Other carbon fixation pathways
acek01100  Metabolic pathways
acek01110  Biosynthesis of secondary metabolites
acek01120  Microbial metabolism in diverse environments
acek01200  Carbon metabolism
acek01212  Fatty acid metabolism
Module
acek_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:acek00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FLP30_05395 (accC)
   00640 Propanoate metabolism
    FLP30_05395 (accC)
  09102 Energy metabolism
   00720 Other carbon fixation pathways
    FLP30_05395 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FLP30_05395 (accC)
Enzymes [BR:acek01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     FLP30_05395 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     FLP30_05395 (accC)
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp GARS_A
Other DBs
NCBI-ProteinID: QEO18573
UniProt: A0A5C1YRZ3
LinkDB
Position
complement(1212697..1214040)
AA seq 447 aa
MFSKILIANRGEIALRVLRACRELGIKTVAVHSTADADAMHVRLADEAVCIGPPASRDSY
LNVAAILSAATITGAEAIHPGYGFLSENADFAETVEAHGLVFIGPTAQHIRMMGDKITAK
TTMLALGVPLVPGSDGELHNLDEAREVAERVGYPVLIKAAAGGGGRGMKVAHSADELAEA
WDMARTEARAAFGNDAVYMEKYMDRPRHIELQVLGDNYGNVVHFGERDCSLQRRHQKLLE
EAGSPAIDPEQRDTIGRTATEALSRMGYRNAGTLEFLYQDGQFCFIEMNTRLQVEHPVTE
MVCDVDLVREQIRLAAGEKLGYTQEDVTFSGHAIECRINAEDPATFAPCPGTVAVYHPPG
GLGVRVDSALYTGYRVPPFYDSMIAKLIVHAPTREQAIARMQRALDEFVVEGIKTVIPLH
RDILEDPGFQKGDYTIHWLEQFTARPR
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgttttccaaaatcctcatcgccaaccgtggcgaaattgcccttcgcgtcctgcgcgcc
tgccgggaacttggcatcaagactgtggccgttcattcgaccgccgacgccgacgccatg
catgtgcgcctggcggacgaggccgtgtgcatcgggccaccggcctcgcgcgattcgtac
ctgaatgtggcagccattctgtcggcagcaaccataacgggggcggaagccatccacccc
ggctatggctttctgtccgaaaacgccgattttgctgaaacggtggaagcccacggcctg
gtctttattggccccacggcccagcacatccgcatgatgggtgacaagatcaccgccaag
accaccatgctggcccttggcgtgccgctggtgcccggctccgacggggaactgcataat
ctggacgaagcgcgcgaagtggcagagcgcgtgggctatccggtgctgatcaaggctgcc
gctggcggcggcgggcggggcatgaaagtggcccactccgccgacgaactggccgaagcc
tgggacatggcccggacagaagcgcgtgcagcctttggcaacgacgcggtctacatggaa
aaatacatggaccgcccccgccatatcgagttgcaggtgctgggcgacaactacggcaac
gtggtgcattttggcgagcgtgactgctcgctccagcgccgccaccagaaactgctggaa
gaggccgggtcccccgcgatcgaccccgagcagcgcgacaccatcggccgcaccgcgacc
gaggccctatcacgcatgggctatcgcaacgcgggcacgctggagttcctgtaccaggac
gggcagttctgctttatcgaaatgaacacccgcctgcaggtggaacacccggtgaccgaa
atggtctgcgacgtggacctggtgcgtgaacagatccgcctggctgcgggcgaaaagctt
ggctacacgcaggaggacgttaccttctccggccatgcgatcgaatgccgcatcaacgcc
gaagaccccgccacctttgccccctgccccggcacggttgcggtctatcacccgcccggc
ggtctgggcgtgcgggtggacagcgccctgtacaccggctaccgcgtgccgccgttctat
gacagcatgatcgccaagctgatcgtgcacgcccccacgcgtgagcaggctattgcccgc
atgcagcgcgcgctggatgaatttgtggtggaaggcatcaaaaccgtgatcccgctccac
cgcgatattctggaagacccgggctttcagaaaggcgattacaccatccactggctggaa
cagtttaccgcccgcccgcgctga

DBGET integrated database retrieval system