KEGG   Acetobacter vaccinii: FLP30_09870
Entry
FLP30_09870       CDS       T07989                                 
Symbol
ntrC
Name
(GenBank) nitrogen regulation protein NR(I)
  KO
K07712  two-component system, NtrC family, nitrogen regulation response regulator GlnG
Organism
acek  Acetobacter vaccinii
Pathway
acek02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acek00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FLP30_09870 (ntrC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:acek02022]
    FLP30_09870 (ntrC)
Two-component system [BR:acek02022]
 NtrC family
  GlnL-GlnG (nitrogen regulation)
   FLP30_09870 (ntrC)
SSDB
Motif
Pfam: Sigma54_activat Response_reg Sigma54_activ_2 HTH_8 AAA_5 AAA_2 AAA AAA_16 Mg_chelatase HTH_30 Phage_NinH HTH_17 Hpr_kinase_C IIGP TIP49 AAA_3 nSTAND3
Other DBs
NCBI-ProteinID: QEO18000
UniProt: A0A5C1YS68
LinkDB
Position
2192969..2194417
AA seq 482 aa
MTPPPTILVADDDRSIRTVLGQALGRAGYQVRSTPYASTLWQWVEEGEGDLVITDVVMPD
GSGLDLIPRIRQTRPDLRIVVMSAQSTLTMAVKAMQRGAFEYLAKPFDLAELQAVVARAL
TAPAREGESTQQDGPPEERLPLIGQSVAMQAIYRTIARLTTSDLTVMITGESGTGKELVA
YALHEYGHRRNGPFVAVNMAAIPRTQIESELFGYERDGVQGRMPGRFEQASGGTLFLDEI
GDMPQEAQTRLLRVLQEGEFTTVGGTRPLKADVRIVAATHRDLRQAIQSGTFREDLFYRL
NVVPLRLPPLRERLEDIPLLARHFLNQCREEGGGYRQIDEDAISSLQAWRWPGNVRELEN
LIRRVVVLHSQETITRDLVETELAENLALESGREPPVEGGGEALVDAVSRHIGRYLQAGR
DGVSLYDLHARIIAEVERPLIQMTLAETRGNQIKAAAMLGLNRNTLRKKIRDLEIPVVRG
VV
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgacgccaccgcccaccattcttgttgctgatgacgaccgctcaatccgcaccgttctg
gggcaggccttggggcgtgcgggttatcaggtccgcagcaccccctatgcctccaccttg
tggcaatgggtggaggagggagagggcgatctggttattaccgatgtggtcatgcccgac
gggagtgggctggaccttatcccacgtattcgccagacccgacctgatctgcggattgtg
gtcatgagtgcgcagtccaccctgaccatggccgtcaaggccatgcagcgtggtgcgttt
gagtatctggccaaaccgtttgatctggcggaattgcaggctgttgtcgccagggcgctg
acagcccccgcgcgggagggggaaagcacacagcaggatggcccgccggaggaacgcctg
cccctgatcgggcagtcggtagccatgcaggcgatttaccgcaccattgcccgcctgacg
acgtccgatctgacagtcatgatcacgggggaaagtggcacgggcaaggaactggttgcc
tatgccctgcatgaatatggccaccgccggaatgggccatttgttgcggtgaacatggcg
gcgatcccccgcactcagattgagagtgaactgttcggctacgagcgtgatggtgtgcag
gggcgcatgcccggtcggtttgagcaggccagcggcggcaccctgtttttggatgaaatc
ggcgatatgccgcaggaggcccagacccgcctgctcagggtcttgcaggaaggcgagttt
acaacagtcggtggcacccgcccgctcaaagccgatgtcagaattgtagctgcaacccac
cgtgacctgcgacaggccattcagtccggcactttccgcgaggatctgttttatcggctc
aatgtggtgcccttgcgcctgccccccctgcgggagcggctggaggatattcccttgctg
gcacgccacttcctcaaccagtgccgggaggaaggcggtgggtaccgccagattgatgag
gatgcgatcagcagcctgcaggcctggcgctggccggggaatgtgcgggaactggaaaac
ctgatccggcgtgttgtcgtgctgcactcgcaggaaaccattaccagagacctggtggaa
accgagctggccgaaaatctggctctggaaagcgggcgtgagccgcctgttgaagggggc
ggggaggctctggtggatgccgtgtcccgccatatcgggcgttatctgcaagccggtcgg
gacggtgtttctctctacgacctgcatgccaggattattgccgaggtagaacgcccgttg
atccagatgacattggcagaaacgagaggcaaccagatcaaagccgctgccatgcttggc
cttaaccgcaacacgctccgcaagaaaatccgtgatctggaaattcccgtcgtgcgcggc
gtggtgtga

DBGET integrated database retrieval system