Acetobacter vaccinii: FLP30_10535 Help Entry FLP30_10535       CDS       T07989                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acek  Acetobacter vaccinii Pathway acek01100   Metabolic pathways acek01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acek00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FLP30_10535    00074 Mycolic acid biosynthesis     FLP30_10535   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FLP30_10535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QEO18117 UniProt:  A0A5C1YT12 LinkDB All DBs Position complement(2339045..2339296) Genome browser AA seq 83 aa AA seqDB search MSETVEGVSALIIQKLLANPKVPRNIDGNCKIMEDLAFDSLAVMNFVMEVEDSLDVSVPL DKLADIRTINDLASCIVDLKNRG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaaccgttgaaggcgtttccgcgctgatcatccaaaagctgctcgccaacccg aaggttccccggaacatcgatggcaactgcaagatcatggaagaccttgcctttgattct ctggcggtcatgaattttgtcatggaagtggaagacagcctcgatgtttctgtcccgctg gacaagctggctgatatccgcacgatcaatgatcttgcctcctgcatcgtcgatctgaaa aaccgagggtaa

DBGET integrated database retrieval system