KEGG   Anaerocolumna cellulosilytica: acsn021_30350
Entry
acsn021_30350     CDS       T06764                                 
Symbol
coaD
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
acel  Anaerocolumna cellulosilytica
Pathway
acel00770  Pantothenate and CoA biosynthesis
acel01100  Metabolic pathways
acel01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:acel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    acsn021_30350 (coaD)
Enzymes [BR:acel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     acsn021_30350 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: BCJ95466
UniProt: A0A6S6R097
LinkDB
Position
complement(3668755..3669243)
AA seq 162 aa
MRIGIYPGSFDPVTLGHLDIIYRASKLVDRLIIGVLTNSKKSPLFTTQERVLLLEEATKG
IPNVVIEAYQGLLVDFAEERQAGMIVRGLRAITDFEYELQLAQTNHKINPKVDTVFLTTS
VEYAYLSSSMVREIASYGGKIDQFVPACVAQSMYEKYNLRRG
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagaataggtatttatcctggcagttttgatcctgttacgctgggtcatcttgatatt
atttatagagcatctaagttggtggatcgtctaattataggagtactaaccaacagtaag
aaatcccctttgtttacgacgcaggaaagagttctgttattggaggaggcaacaaagggt
atacctaatgtagtaattgaagcgtatcaggggctgctggtagattttgcagaagaaaga
caggcaggaatgatagtaagaggcttaagggctattacggattttgaatatgaattgcag
ttagctcagacaaaccataaaataaatcctaaggtggatacagtatttcttacaaccagt
gtggaatatgcctatttaagctcaagtatggtaagagaaattgccagctatggcggaaaa
attgaccagtttgttccggcatgtgttgcacaaagtatgtatgaaaaatataatttaagg
agaggttag

DBGET integrated database retrieval system