Atta cephalotes (leaf cutting ant): 105617956 Help Entry 105617956         CDS       T04923                                  Name (RefSeq) GTPase HRas   KO K07827   GTPase KRas Organism acep  Atta cephalotes (leaf cutting ant) Pathway acep04013   MAPK signaling pathway - fly acep04068   FoxO signaling pathway acep04137   Mitophagy - animal acep04140   Autophagy - animal acep04150   mTOR signaling pathway acep04213   Longevity regulating pathway - multiple species acep04214   Apoptosis - fly acep04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:acep00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     105617956    04068 FoxO signaling pathway     105617956    04150 mTOR signaling pathway     105617956  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105617956    04137 Mitophagy - animal     105617956   09143 Cell growth and death    04214 Apoptosis - fly     105617956  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     105617956   09149 Aging    04213 Longevity regulating pathway - multiple species     105617956  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acep04131]     105617956   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:acep04031]     105617956 Membrane trafficking [BR:acep04131]  Endocytosis   Macropinocytosis    Ras GTPases     105617956 GTP-binding proteins [BR:acep04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105617956 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin ERCC4 Ldh_1_N Motif Other DBs NCBI-GeneID:  105617956 NCBI-ProteinID:  XP_012054882 UniProt:  A0A158NBH4 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL QQSWAVNMTQAREVARQYGVPFVETSAKTRMGVDDAFYTLVREIRKDKERTGKPPGSSGH KKRRCFIL NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataagctcgtggtagttggagctggaggtgttggaaagtctgctttaacc attcaactcatacagaatcattttgtcgacgagtatgatccaacgatcgaagactcgtat cgaaaacaggtggtgatagatggtgaaacgtgccttctcgatatattagacacagctgga caagaagaatatagtgcaatgagagatcagtatatgagaacaggagaaggattcttgtta gtgtttgccgtaaattcggctaaaagttttgaggatattggtacatatagggaacaaata aaacgagtaaaagatgcggaagaagtaccaatggtcttagtgggaaataagtgtgatctt caacagtcttgggcggtaaacatgactcaagcgagagaggtcgcgcgacagtatggtgtg ccatttgtagaaacttccgcgaaaacgagaatgggtgtagacgatgcattttatactttg gtcagggaaatacgaaaagataaagaacgcacaggtaaaccacctggcagtagtgggcac aagaaacgtcgatgctttattttataa

DBGET integrated database retrieval system