Atta cephalotes (leaf cutting ant): 105620318 Help Entry 105620318         CDS       T04923                                  Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism acep  Atta cephalotes (leaf cutting ant) Pathway acep04144   Endocytosis acep04517   IgSF CAM signaling acep04518   Integrin signaling acep05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:acep00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     105620318    04518 Integrin signaling     105620318  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105620318  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105620318  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acep04131]     105620318    03036 Chromosome and associated proteins [BR:acep03036]     105620318   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acep04147]     105620318    04031 GTP-binding proteins [BR:acep04031]     105620318 Membrane trafficking [BR:acep04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     105620318  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     105620318   Macropinocytosis    Ras GTPases     105620318 Chromosome and associated proteins [BR:acep03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     105620318 Exosome [BR:acep04147]  Exosomal proteins   Exosomal proteins of microglial cells    105620318   Exosomal proteins of breast milk    105620318 GTP-binding proteins [BR:acep04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     105620318 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  105620318 NCBI-ProteinID:  XP_012057210 UniProt:  A0A158NI52 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGDPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQRTPFLLVGTQIDLR DDVATTEKLAKNKQKPISGEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPP EPVKKRKCILL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacgataaagtgtgttgtggtaggcgatggagcagttggtaaaacatgtctcttg atttcgtataccacaaacaagtttccttctgaatatgtgcctactgtttttgacaactat gcagtaactgtgatgataggaggtgatccatatacattaggattatttgatacagcaggt caggaagattatgatagattgcgtcctttaagttatcctcagactgacgtgtttctcgtg tgcttctcggttgtgtcaccgtcatcattcgaaaatgtaaaagaaaagtgggtaccagaa ataacgcatcattgtcagagaactccatttttacttgtcggaactcaaattgatttaaga gatgatgtcgcaacaacagagaaacttgcaaagaacaaacagaagccaatatctggcgaa cagggagaaaaacttgctaaggaactcaaggctgtaaaatatgtagagtgcagtgctctg acgcagaaaggattgaagaatgtattcgacgaagctattttagctgcattggaaccaccc gagccagtgaagaagaggaagtgtatacttctgtaa

DBGET integrated database retrieval system