Atta cephalotes (leaf cutting ant): 105623256 Help Entry 105623256         CDS       T04923                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A [EC:3.6.5.2] Organism acep  Atta cephalotes (leaf cutting ant) Pathway acep04137   Mitophagy - animal acep04140   Autophagy - animal acep04142   Lysosome biogenesis acep04144   Endocytosis acep04145   Phagocytosis acep04148   Efferocytosis Brite KEGG Orthology (KO) [BR:acep00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105623256    04145 Phagocytosis     105623256    04142 Lysosome biogenesis     105623256    04140 Autophagy - animal     105623256    04137 Mitophagy - animal     105623256    04148 Efferocytosis     105623256  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acep04131]     105623256   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acep04147]     105623256    04031 GTP-binding proteins [BR:acep04031]     105623256 Enzymes [BR:acep01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.5  Acting on GTP to facilitate cellular and subcellular movement     3.6.5.2  small monomeric GTPase      105623256 Membrane trafficking [BR:acep04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     105623256  Endosome - Golgi transport     105623256 Exosome [BR:acep04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105623256   Exosomal proteins of other body fluids (saliva and urine)    105623256   Exosomal proteins of colorectal cancer cells    105623256   Exosomal proteins of bladder cancer cells    105623256 GTP-binding proteins [BR:acep04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     105623256 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 AAA_16 Septin PduV-EutP AAA_7 AAA_22 NTPase_1 G-alpha AAA_24 AAA_5 AAA_14 NB-ARC ATPase_2 NACHT SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  105623256 NCBI-ProteinID:  XP_012060044 UniProt:  A0A158NR86 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVEDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVSAPTSFKSLDSWRDEFLIQASPRDPDNFPF VVLGNKVDLESRAVSSKRAQQWCQSKNNIPYFETSAKEAINVEQAFQTIAKNALAQESEV ELYNEFPDQIKLTNDQRSNGRGDSCAC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcatcccgcaagaaagttttactgaaagtaattatccttggggattcgggagttggg aaaacttctttaatgaatcaatatgtcaataagaagtttagcaaccaatataaagcgaca ataggggcagattttttgactaaggaagtgatggtagaggatagaatagtcactatgcag atttgggataccgctggacaggagaggtttcaatcattaggagtggctttttatagaggc gcagactgttgtgtactggtatttgatgtatcggctccaactagcttcaaatctctagat tcatggagagatgaatttttaattcaagcctcgcctcgagatccagacaactttccgttt gtcgtgctcgggaacaaagtagatcttgaatcaagagcagtctcaagcaagagagcacaa cagtggtgtcaatcaaagaacaatattccatattttgaaactagtgcaaaagaggctatt aatgtcgagcaagctttccaaacgatagctaagaatgctttagctcaagaaagtgaagtc gaactttacaatgaattcccggatcaaatcaaattgaccaacgaccaaagaagcaatggt agaggtgattcatgtgcttgctag

DBGET integrated database retrieval system