Atta cephalotes (leaf cutting ant): 105623401 Help Entry 105623401         CDS       T04923                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism acep  Atta cephalotes (leaf cutting ant) Pathway acep04145   Phagocytosis acep04814   Motor proteins Brite KEGG Orthology (KO) [BR:acep00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     105623401   09142 Cell motility    04814 Motor proteins     105623401  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:acep03037]     105623401    04812 Cytoskeleton proteins [BR:acep04812]     105623401 Cilium and associated proteins [BR:acep03037]  Motile cilia and associated proteins   Dynein arm    105623401 Cytoskeleton proteins [BR:acep04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      105623401 SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 DUF7917 Motif Other DBs NCBI-GeneID:  105623401 NCBI-ProteinID:  XP_012060185 UniProt:  A0A158NRM7 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MEQDAQEELQFVVDDVSTIIKEAIEVSIGGNTYQHNKVNQWTSNVVEACLGNLTKLQKAY KYIVTCTIMQKNGAGLHTASSCYWDNATDGSCTVRWENKTMYCIVSVFGLAL NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggagcaagatgcgcaagaagagttgcaatttgtagtagatgacgtgagtaccattatc aaggaagcaattgaagtgtcaataggtggcaatacttatcagcataataaagttaatcaa tggacttcgaacgtggtagaggcttgcttgggcaatcttacaaaattacagaaagcctat aaatatatcgtgacttgcacaatcatgcagaaaaacggagctggacttcatactgcaagt tcatgttactgggataatgctactgatggcagttgcacagtacgctgggaaaataaaact atgtattgtattgtatctgtttttggattggctctataa

DBGET integrated database retrieval system