Atta cephalotes (leaf cutting ant): 105623569 Help Entry 105623569         CDS       T04923                                  Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism acep  Atta cephalotes (leaf cutting ant) Brite KEGG Orthology (KO) [BR:acep00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:acep03037]     105623569 Cilium and associated proteins [BR:acep03037]  Primary cilia and associated proteins   BBSome    105623569 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  BBIP10 DUF2098 Motif Other DBs NCBI-GeneID:  105623569 NCBI-ProteinID:  XP_012060347 UniProt:  A0A158NS39 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MSEPTENQMEQCDIVLPRQGLLYQTDALNYILCKPKLIPLKSVTLEKLEKMQKDAEIKVK ESQEAEDSLNASA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgtcagagcctacagagaatcagatggaacagtgcgacatagtcttgccaagacaaggt ctgttatatcagacagatgcattgaattacatactctgtaaaccgaagttgatcccgttg aaatcagtcacgttggaaaaacttgagaagatgcagaaagatgcggagatcaaagttaaa gagtcgcaagaggcagaagatagtcttaatgcaagtgcataa

DBGET integrated database retrieval system