Atta cephalotes (leaf cutting ant): 105623714 Help Entry 105623714         CDS       T04923                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism acep  Atta cephalotes (leaf cutting ant) Pathway acep04013   MAPK signaling pathway - fly acep04145   Phagosome acep04148   Efferocytosis acep04310   Wnt signaling pathway acep04620   Toll-like receptor signaling pathway acep05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:acep00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     105623714    04310 Wnt signaling pathway     105623714  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105623714    04148 Efferocytosis     105623714  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105623714  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105623714  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acep04131]     105623714   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acep04147]     105623714    04031 GTP-binding proteins [BR:acep04031]     105623714 Membrane trafficking [BR:acep04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     105623714  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     105623714   Macropinocytosis    Ras GTPases     105623714  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     105623714 Exosome [BR:acep04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105623714   Exosomal proteins of other body fluids (saliva and urine)    105623714   Exosomal proteins of colorectal cancer cells    105623714   Exosomal proteins of bladder cancer cells    105623714 GTP-binding proteins [BR:acep04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     105623714 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  105623714 NCBI-ProteinID:  XP_012060487 UniProt:  A0A158NSH9 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPKRRCFLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagccatcaagtgcgtggtcgtcggcgacggtgcggtaggtaaaacatgcttatta ataagctacaccaccaatgcatttcctggggaatatattccaacggtattcgacaactat tctgcgaatgtgatggtcgatggaaagccaattaatcttggcttgtgggacacagcggga caagaggattatgacagactacggccattgtcttatccacaaactgatgtctttctcatc tgcttttcattggtgaacccggcaagttttgaaaatgtgcgtgccaaatggtatccagaa gtacgtcatcactgtcctgctactccaattattctagttggcactaaactagatctgcgt gaggacaaggagactatcgaacgtttgaaagacaaaaaactagctcccattacttatcct cagggtttagcaatggcaaaggagatcggtgctgtaaaatatttggaatgctccgctttg acacaaaaaggcttgaagactgtgtttgacgaagcgatacgcgctgtactgtgcccggtt ctgcaagtgaagccaaagcgcagatgtttccttctataa

DBGET integrated database retrieval system