Atta cephalotes (leaf cutting ant): 105627128 Help Entry 105627128         CDS       T04923                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism acep  Atta cephalotes (leaf cutting ant) Brite KEGG Orthology (KO) [BR:acep00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:acep03041]     105627128   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:acep04052]     105627128 Spliceosome [BR:acep03041]  Complex B   Other components    Complex B specific factors     105627128 Cytokines and neuropeptides [BR:acep04052]  Neuropeptides   Unclassified    105627128 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler OTU1_UBXL Motif Other DBs NCBI-GeneID:  105627128 NCBI-ProteinID:  XP_012063802 UniProt:  A0A158P1Z4 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MLEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTHWEKIVLKKWYTIFKDHIKLQDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgttagagataacgtgcaacgaccgtcttggtaaaaaggttagagtgaaatgcaaccca gacgacaccataggagacctgaaaaaattgatagccgcccaaactggaacacactgggag aagattgtattaaagaagtggtatactattttcaaggaccatataaagttgcaggactat gagatacacgacggcatgaacttagaactctattatcaataa

DBGET integrated database retrieval system