Apis cerana (Asiatic honeybee): 107994040 Help Entry 107994040         CDS       T07475                                  Name (RefSeq) cdc42 homolog isoform X1   KO K04393   cell division control protein 42 Organism acer  Apis cerana (Asiatic honeybee) Pathway acer04144   Endocytosis acer04517   IgSF CAM signaling acer04518   Integrin signaling acer04519   Cadherin signaling acer05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:acer00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     107994040    04518 Integrin signaling     107994040    04519 Cadherin signaling     107994040  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107994040  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     107994040  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acer04131]     107994040    03036 Chromosome and associated proteins [BR:acer03036]     107994040   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acer04147]     107994040    04031 GTP-binding proteins [BR:acer04031]     107994040 Membrane trafficking [BR:acer04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     107994040  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     107994040   Macropinocytosis    Ras GTPases     107994040 Chromosome and associated proteins [BR:acer03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     107994040 Exosome [BR:acer04147]  Exosomal proteins   Exosomal proteins of microglial cells    107994040   Exosomal proteins of breast milk    107994040 GTP-binding proteins [BR:acer04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     107994040 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU DM7 Motif Other DBs NCBI-GeneID:  107994040 NCBI-ProteinID:  XP_016906263 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLR DDAATIEKLAKNKQKPISAEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPP EPVRRRRCIVL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactattaaatgcgttgtagttggagatggtgcagtaggtaaaacatgtctgttg atttcatatactaccaataaatttccatccgaatatgttccaacagtatttgataattat gctgtaactgttatgattggtggtgaaccatatactttaggattatttgatacagcaggt caagaagattatgatcgattacgtcctttgagttatcctcaaactgatgtatttcttgtt tgtttttcggttgtatctccatcatcttttgaaaatgttaaggaaaagtgggttccagaa ataactcatcattgccaaaagactccatttttgctagttggaactcagattgatttgaga gatgatgcagcaactattgaaaaacttgcaaaaaataaacaaaagcctatatcagctgaa caaggtgaaaaacttgccaaggaactcaaagcagtaaaatatgtcgaatgtagtgctctt acacaaaaaggtttaaaaaacgtattcgacgaagcaattttagcagcattagaacctcca gaaccagttagaagaagacgatgtattgttttgtag

DBGET integrated database retrieval system