Apis cerana (Asiatic honeybee): 107998617 Help Entry 107998617         CDS       T07475                                  Name (RefSeq) eclosion hormone   KO K28249   eclosion hormone Organism acer  Apis cerana (Asiatic honeybee) Brite KEGG Orthology (KO) [BR:acer00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:acer04052]     107998617 Cytokines and neuropeptides [BR:acer04052]  Neuropeptides   Unclassified    107998617 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Eclosion Csp LSR Motif Other DBs NCBI-GeneID:  107998617 NCBI-ProteinID:  XP_016913456 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MNASIRVLLVLFLTCSTVFLLVAGSVHFERAIGICIRNCAQCKKMFGPYFHGQKCADSCF NNKGKLIPDCEDEDSIQPFLQALDSEY NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaacgcttcgatccgtgttttgctggtgctctttttaacctgttcaacggtgttcctg ctcgttgcgggaagcgttcattttgaacgggccataggaatttgtatccgaaattgcgcc caatgcaagaaaatgttcggcccgtacttccacggacaaaagtgtgccgattcttgcttc aacaacaaaggaaaactcattcctgactgcgaggatgaggattcgatccaaccattcctc caagcgcttgacagcgaatattag

DBGET integrated database retrieval system