Apis cerana (Asiatic honeybee): 107999025
Help
Entry
107999025 CDS
T07475
Name
(RefSeq) proton channel OtopLc-like isoform X1
KO
K26153
proton channel OTOP
Organism
acer
Apis cerana (Asiatic honeybee)
Brite
KEGG Orthology (KO) [BR:
acer00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
acer02000
]
107999025
Transporters [BR:
acer02000
]
Other transporters
Pores ion channels [TC:
1
]
107999025
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Otopetrin
Motif
Other DBs
NCBI-GeneID:
107999025
NCBI-ProteinID:
XP_016914144
LinkDB
All DBs
Position
Unknown
AA seq
646 aa
AA seq
DB search
MNNSQSNITTTTCELKNRDAPPSITLSSEADGKECLLSPRGRMSHSRRQSMSFTAVMNHR
RGLLGALISGIGSNMSLPSCIPQDQEFLPGQTGTGRKTQLLLNNRNQSWEKNEHEAQKQR
PNFLPLAPVGTGCVSVNTLDPMKAKQRMMEEKSKLTERRNCHAEMVSIMSTLYAKLLIVI
GLAVPITASVTERVPASLNQGFYLYLYVVSVAFVISMYVIVLRDKAVWNVKRRSGGGKEQ
ALKYDEKGDRVNPSQTQQYGSFCLRLGAVGFGAGSLVFTGLQIGAEIASGPFRAITPGAR
LLLVTAQMHFIFLNSKSLSLAKHTALAKLGLMHMIATNLCEWLQALVEETQHEIDQLGDT
HDDDDGILKSLLRDASPFLFPCTIEFSLICAVILFEMWKRADERIDAKGETPARSSYHLS
IDCSSSHRGLFGGILIVAATILSLIMFFVLKETKMEIAIVQVTALDATILTLGMIASIAG
TLKLQALQQKIIKPSDLDTTLLAAAQAGVYLHCLFGVVGDILTMGPTWALSLITDLLALM
QSTSQTLLIKIAWGRRCSRNDKPGKELITFLIVVNIALWTVNTLEKSRAGVRPDHLRFFG
VWAWTIITHVSMPLAIFYRFHSAICLFEIWKTCYKCRSNSVVHTPY
NT seq
1941 nt
NT seq
+upstream
nt +downstream
nt
atgaataatagtcaatccaatataacgacaacgacttgcgagttgaaaaatcgcgatgcg
ccgccatcgataaccctatcgtcagaggctgatgggaaagagtgcctgttgtcgcctcga
ggaaggatgtcgcattcacggagacaaagcatgtccttcaccgccgttatgaaccatcga
agaggcctcctcggcgcgttgatttcaggtataggcagcaacatgtcgctgccctcgtgc
atccctcaagaccaagagtttttacccggtcaaacgggaactgggcgcaaaacgcaattg
ttgttgaacaatcggaatcaatcgtgggagaagaacgagcacgaggcgcaaaagcaacga
cccaattttctcccactggcacctgttggcacgggctgcgtgagcgtcaacactctcgat
ccgatgaaagcgaagcaacggatgatggaagaaaaatcaaagttaacggagaggaggaat
tgccacgcggaaatggtgtccatcatgagcaccctttacgcgaaattgttgatcgtgatc
gggctggccgtgcccataactgccagcgtgacggagagagttccagcttcgttgaatcag
ggtttctatttgtatctgtacgtggtcagcgtggcattcgtgatctcgatgtacgttatc
gtattaagagacaaagctgtttggaatgtgaagcggaggagcggagggggaaaggagcag
gcgttgaaatacgacgagaagggggatcgcgtaaatcctagtcagacgcaacagtacggg
agcttttgtctgagactcggcgctgtgggatttggcgctggctcgttggtatttacggga
ttgcaaattggggcggaaatagcttccggcccgttcagggcgattacaccgggtgccagg
ctgctgctggtcacggcccagatgcattttatatttctcaacagcaaaagtctcagcttg
gccaagcacaccgcacttgccaagttgggtctgatgcacatgatcgcgacgaatctctgc
gagtggttgcaggcgttggtcgaggaaacgcaacacgagatcgatcagctaggcgacacg
cacgacgacgatgacgggatactgaaatcgcttctgagggacgcgagcccgttccttttc
ccgtgcacaattgaattcagtttaatttgcgcggtgatactgttcgagatgtggaagagg
gcggacgagaggatcgatgcaaagggcgagaccccggccagatcttcgtatcatcttagc
atagattgcagcagctctcacagaggtctcttcggcgggatattgatcgttgcagcgact
atactgagcttgatcatgttcttcgtcctgaaggagacgaaaatggagattgcgatcgtt
caggtgaccgcgctcgacgccactatactcacgttaggtatgatcgcttcgatcgcgggc
acgttgaagttgcaagcgttgcagcagaagattatcaaaccatcggacttggacaccacg
ctgttggcagcggctcaagccggggtctatctgcattgtctgttcggggtcgttggtgat
atattgacaatgggaccgacctgggcgttatcgctgatcacagatttgttggccttaatg
cagagcaccagccagacgttgctcatcaaaatcgcatggggaagacgttgttcgagaaac
gacaaacccggcaaggagttaatcacattcctaatagtcgtcaacatcgccttgtggacg
gtgaacactttggagaaatctcgcgcgggggttcgtcccgaccatctgcgattcttcggc
gtatgggcatggacgattatcactcacgtgtctatgccattggctatattctatcggttc
cactcagccatatgtctgttcgagatatggaagacgtgttacaaatgcagatcgaacagc
gtcgtccataccccttactga
DBGET
integrated database retrieval system