Apis cerana (Asiatic honeybee): 107999129 Help Entry 107999129         CDS       T07475                                  Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism acer  Apis cerana (Asiatic honeybee) Pathway acer04144   Endocytosis acer04517   IgSF CAM signaling acer04518   Integrin signaling acer04519   Cadherin signaling acer05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:acer00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     107999129    04518 Integrin signaling     107999129    04519 Cadherin signaling     107999129  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107999129  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     107999129  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acer04131]     107999129    03036 Chromosome and associated proteins [BR:acer03036]     107999129   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acer04147]     107999129    04031 GTP-binding proteins [BR:acer04031]     107999129 Membrane trafficking [BR:acer04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     107999129  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     107999129   Macropinocytosis    Ras GTPases     107999129 Chromosome and associated proteins [BR:acer03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     107999129 Exosome [BR:acer04147]  Exosomal proteins   Exosomal proteins of microglial cells    107999129   Exosomal proteins of breast milk    107999129 GTP-binding proteins [BR:acer04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     107999129 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  107999129 NCBI-ProteinID:  XP_016914287 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGDPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPRTPFLLVGTQIDLR DDVATIEKLAKNKQKPISAEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPP EPVKKRKCTLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacgataaaatgcgttgtagttggagatggagctgtgggtaaaacttgtcttttg atttcatatacaaccaataagtttccatccgaatatgtacctacagtttttgacaattat gcagtaacagtaatgatcggcggagatccatatacattgggattattcgatactgctggt caggaggattacgacagacttagacctttaagttatccccaaacggatgtatttcttgtt tgtttttcagttgtttccccatcatcttttgaaaatgttaaagaaaagtgggtacccgaa ataacacatcattgtccaaggacgccgtttttattggttggtactcaaatcgatttgaga gatgatgttgccactatcgaaaaattggcaaagaataaacaaaagccaatatccgcggag caaggggaaaagcttgccaaagaattaaaagcagtgaaatacgtagaatgtagtgctctt acgcagaaaggtttgaaaaatgtgtttgatgaagctattttagccgccttagaacctcca gagccagtaaagaagagaaagtgtacacttttgtaa

DBGET integrated database retrieval system