Apis cerana (Asiatic honeybee): 108000070 Help Entry 108000070         CDS       T07475                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism acer  Apis cerana (Asiatic honeybee) Pathway acer04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:acer00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     108000070  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:acer04121]     108000070    03400 DNA repair and recombination proteins [BR:acer03400]     108000070 Ubiquitin system [BR:acer04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      108000070    Cul5 complex      108000070 DNA repair and recombination proteins [BR:acer03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      108000070 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Lin1244_N Motif Other DBs NCBI-GeneID:  108000070 NCBI-ProteinID:  XP_016915708 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MDVFLMIRRKNMTIFTDAKDNTTVLELKKIIEGILKISPVNQQLFNKDNVLMSDSKFLSD YGLTSATAKPQCPALVGLAIRQDNGQFEPLEMTPFSLPPDLPDVMKSQETNGQEQSP NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtatttctaatgattcgacgaaaaaatatgacaatatttactgatgccaaggat aatactacagttcttgaacttaaaaaaattatagaaggtattttgaaaatatcacctgtg aatcaacagctgttcaataaggataatgttcttatgtcagatagtaaatttttatctgat tatggattaacatcagcaactgcaaaaccacaatgtcctgcattagtaggattagctata cgtcaagataatggtcaattcgaacctttagagatgacaccattttcattaccacctgat ttaccagatgttatgaaatctcaagaaactaatggacaagaacaatcaccttga

DBGET integrated database retrieval system