Acetobacter sp. JWB: DS739_08190 Help Entry DS739_08190       CDS       T05544                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acet  Acetobacter sp. JWB Pathway acet01100   Metabolic pathways acet01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acet00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DS739_08190    00074 Mycolic acid biosynthesis     DS739_08190   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DS739_08190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AXC26752 LinkDB All DBs Position 1729305..1729556 Genome browser AA seq 83 aa AA seqDB search MSETVESVSALIIQKLLANPKVPRDIDGNCKIMEDLAFDSLAVMNFVMEVEDSLDVSIPL DKLADIRTINDLAACIVALKNKG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaaccgttgaaagcgtttccgcgctgatcattcaaaagctcctcgctaacccg aaggttccgcgtgacattgatggtaactgcaagatcatggaagatcttgcgtttgattct ttggccgtcatgaacttcgttatggaagttgaagatagcttggatgtttccatcccgctc gacaaacttgccgatatccggacgattaatgaccttgccgcatgcattgtcgctctgaaa aacaaagggtga

DBGET integrated database retrieval system