Acetobacter sp. JWB: DS739_12830 Help Entry DS739_12830       CDS       T05544                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism acet  Acetobacter sp. JWB Brite KEGG Orthology (KO) [BR:acet00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:acet03032]     DS739_12830    03036 Chromosome and associated proteins [BR:acet03036]     DS739_12830    03400 DNA repair and recombination proteins [BR:acet03400]     DS739_12830 DNA replication proteins [BR:acet03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     DS739_12830 Chromosome and associated proteins [BR:acet03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     DS739_12830 DNA repair and recombination proteins [BR:acet03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       DS739_12830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_euk_1 VWA_3 HU-HIG HU-CCDC81_bac_2 DUF7406 Motif Other DBs NCBI-ProteinID:  AXC27534 LinkDB All DBs Position complement(2717481..2717750) Genome browser AA seq 89 aa AA seqDB search MSKAFIAAVIQDSINCTGVAANQAANDLIDAIVEELKREGGFTLPSFGTFTVRKTKARKA LNPRTGEQVKVKAGKTVRFKASPNLKKAV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcaaggcctttattgcagcagtgatccaggactcgatcaactgcaccggcgttgcc gccaatcaggcagcgaatgaccttattgatgcgattgtagaagaactgaagcgtgaaggt ggttttacacttccttctttcggaacgtttacagtgcgtaagaccaaagctcgtaaggcc ttgaaccctcgcacgggtgagcaggtaaaggtcaaagctggcaaaacggtacgttttaaa gcaagtccgaatctgaaaaaggctgtttaa

DBGET integrated database retrieval system