Pseudarthrobacter chlorophenolicus: Achl_2207 Help Entry Achl_2207         CDS       T00834                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism ach  Pseudarthrobacter chlorophenolicus Pathway ach01100   Metabolic pathways ach01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ach00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Achl_2207    00074 Mycolic acid biosynthesis     Achl_2207   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Achl_2207 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Ag332 Motif Other DBs NCBI-ProteinID:  ACL40175 UniProt:  B8HA83 LinkDB All DBs Position 2480919..2481164 Genome browser AA seq 81 aa AA seqDB search MASNEEILAGLAEIVNEETGLAPEAVELDKSFTEDLDIDSISMMTIVVNAEEKFGVRIPD EEVKNLKTVGDAVSFIAGAQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctagcaacgaagaaatcctggccggcctggctgaaatcgtcaacgaggaaaccggc ctggcccccgaagccgtagagctggacaagtccttcaccgaggacctggacatcgactcc atctcgatgatgaccatcgtggtcaacgccgaagagaagttcggcgtccgcattccggac gaagaggtcaagaacctcaagaccgtcggcgacgccgtcagcttcatcgccggcgcacag gcgtag

DBGET integrated database retrieval system