Achromobacter sp. B7: DVB37_05985 Help Entry DVB37_05985       CDS       T05703                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism achb  Achromobacter sp. B7 Pathway achb00998   Biosynthesis of various antibiotics achb01100   Metabolic pathways achb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:achb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DVB37_05985    00074 Mycolic acid biosynthesis     DVB37_05985   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DVB37_05985 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1896 HLH Ribosomal_L50 EutQ DUF1493 Motif Other DBs NCBI-ProteinID:  AYD63515 LinkDB All DBs Position 1334322..1334561 Genome browser AA seq 79 aa AA seqDB search MESIEQRVKKIVAEQLGVNEAEIKNESSFLDDLGADSLDMVELVMALEDEFETEIPDEEA EKITTVQQAIDYINSHGKQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaaagcatcgaacagcgcgtcaagaagatcgtcgctgaacaacttggcgttaacgaa gccgagatcaagaacgaatcctccttccttgacgacctcggtgccgattcgctcgacatg gtcgaactggtcatggcgctcgaagacgaattcgagaccgagatccccgacgaagaggcc gaaaagatcacgaccgtgcaacaagcgattgactacatcaattcgcacggtaagcagtaa

DBGET integrated database retrieval system