Achromobacter sp. B7: DVB37_08635 Help Entry DVB37_08635       CDS       T05703                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism achb  Achromobacter sp. B7 Pathway achb02024   Quorum sensing achb03018   RNA degradation Brite KEGG Orthology (KO) [BR:achb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     DVB37_08635  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     DVB37_08635  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:achb03019]     DVB37_08635    03036 Chromosome and associated proteins [BR:achb03036]     DVB37_08635 Messenger RNA biogenesis [BR:achb03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      DVB37_08635 Chromosome and associated proteins [BR:achb03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     DVB37_08635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 SRP14 Motif Other DBs NCBI-ProteinID:  AYD63978 LinkDB All DBs Position 1915909..1916145 Genome browser AA seq 78 aa AA seqDB search MSNKGQTLQDPFLNTLRKDHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAI STVVPARAVNFQVEVPAE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaataaagggcaaactctgcaagatccgtttctgaacacgctgcgcaaggatcat gtgcccgtgtcgatctacttggtaaacggcatcaagcttcaagggcaaatcgaatctttt gatcagtacgtggtgctgctgcgcaatacggttacgcaaatggtttacaagcatgccatt tccaccgtcgttcccgcgcgcgccgtcaactttcaggtggaagtccctgctgaataa

DBGET integrated database retrieval system