Acanthisitta chloris (rifleman): 103797538 Help Entry 103797538         CDS       T08456                                  Name (RefSeq) C-C motif chemokine 5-like   KO K21083   C-C motif chemokine 17 Organism achl  Acanthisitta chloris (rifleman) Pathway achl04060   Cytokine-cytokine receptor interaction achl04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:achl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103797538  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103797538  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:achl04052]     103797538 Cytokines and neuropeptides [BR:achl04052]  Cytokines   Chemokines    103797538 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103797538 NCBI-ProteinID:  XP_009068005 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MFTAKTVLMLVMLLTLSPHSDSAPYAPSECCFQYIKNPLRLANLKGFYATPKECFSPAIV FETKNGTKVCANPKVTWVQKTVERLLKRKGVHAP NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgttcactgcaaagacagtcctgatgctcgtcatgctcctcaccctctctccacactct gattcagccccttacgctccgtctgagtgctgcttccagtacataaagaatcctctccgg ctggcaaacctgaagggcttctacgcaactcccaaggagtgtttttccccagcaattgtg tttgagaccaagaatgggaccaaggtctgcgcaaacccaaaggtgacctgggtgcagaaa acagttgagaggcttctaaaaaggaaaggagttcatgccccatga

DBGET integrated database retrieval system