Acanthisitta chloris (rifleman): 103798929 Help Entry 103798929         CDS       T08456                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism achl  Acanthisitta chloris (rifleman) Pathway achl04060   Cytokine-cytokine receptor interaction achl04218   Cellular senescence achl04620   Toll-like receptor signaling pathway achl04621   NOD-like receptor signaling pathway achl04622   RIG-I-like receptor signaling pathway achl05132   Salmonella infection achl05164   Influenza A Brite KEGG Orthology (KO) [BR:achl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103798929  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     103798929  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103798929    04621 NOD-like receptor signaling pathway     103798929    04622 RIG-I-like receptor signaling pathway     103798929  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     103798929   09171 Infectious disease: bacterial    05132 Salmonella infection     103798929  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:achl04052]     103798929    00536 Glycosaminoglycan binding proteins [BR:achl00536]     103798929 Cytokines and neuropeptides [BR:achl04052]  Cytokines   Chemokines    103798929 Glycosaminoglycan binding proteins [BR:achl00536]  Heparan sulfate / Heparin   Chemokines    103798929 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103798929 NCBI-ProteinID:  XP_009069464 LinkDB All DBs Position Unknown AA seq 120 aa AA seqDB search MDGKSAAVALVLCLVSVAGSEGKALEKTEDKGSQCRCISTHSKFIPPKTVQDVRLSQRGP HCKSVEIIATLRGGREVCLEPTAPWVWLTVKALLARARDNTEAPAKQKLRKIIPWSSSKI NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggatggcaaatctgctgctgtcgctttggttctctgtctggtctcagtggcagggtca gaaggtaaggccctggagaagacagaggataaaggctcccaatgccggtgcataagcact cattccaagttcatccctcccaagactgtccaggatgtgagattaagccaacgaggacct cactgcaaaagtgtggaaatcatagctacactgagaggtggcagagaggtgtgcctggaa cccacggcgccctgggtctggctcactgtgaaggctctgttggccagggccagggacaat acagaggcaccagccaaacaaaagctgaggaaaattataccttggagttcttcaaagata tga

DBGET integrated database retrieval system