Acanthisitta chloris (rifleman): 103800109 Help Entry 103800109         CDS       T08456                                  Symbol RAB14 Name (RefSeq) ras-related protein Rab-14   KO K07881   Ras-related protein Rab-14 Organism achl  Acanthisitta chloris (rifleman) Pathway achl04148   Efferocytosis Brite KEGG Orthology (KO) [BR:achl00001]  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     103800109 (RAB14)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:achl04131]     103800109 (RAB14)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:achl04147]     103800109 (RAB14)    04031 GTP-binding proteins [BR:achl04031]     103800109 (RAB14) Membrane trafficking [BR:achl04131]  Protein recycling   Rab GTPases and associated proteins    Rab GTPases     103800109 (RAB14) Exosome [BR:achl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103800109 (RAB14)   Exosomal proteins of other body fluids (saliva and urine)    103800109 (RAB14)   Exosomal proteins of colorectal cancer cells    103800109 (RAB14) GTP-binding proteins [BR:achl04031]  Small (monomeric) G-proteins   Rab Family    Rab2/4/14 [OT]     103800109 (RAB14) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Gtr1_RagA Septin AAA_16 AAA_22 SRPRB Motif Other DBs NCBI-GeneID:  103800109 NCBI-ProteinID:  XP_009070719 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKI KLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVII LIGNKADLEAQRDVTYEEAKQFAEENGVCFLL NT seq 457 nt NT seq  +upstreamnt  +downstreamnt atggcaactgcaccttacaactattcctacatctttaaatacatcattattggggacatg ggtgtaggaaagtcctgtttgctgcaccaattcacagaaaagaagtttatggcagactgt ccccacacaattggtgttgaatttggcacaagaataattgaagttagtggccaaaaaatt aaactacagatttgggatacagcaggacaagagagattcagggctgtcacacgaagctac tacagaggagcagcaggagctctcatggtctacgacattaccagaagaagtacatataat cacctaagcagctggctgacagatgcaaggaacctcaccaatccaaatactgtgataatc ctcataggaaacaaagcagacctggaagcacagagggatgttacatatgaagaagccaaa caatttgctgaagaaaatggtgtgtgttttctcttga

DBGET integrated database retrieval system