Acanthisitta chloris (rifleman): 103800256 Help Entry 103800256         CDS       T08456                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism achl  Acanthisitta chloris (rifleman) Brite KEGG Orthology (KO) [BR:achl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:achl03036]     103800256   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:achl04147]     103800256 Chromosome and associated proteins [BR:achl03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103800256 Exosome [BR:achl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103800256 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  103800256 NCBI-ProteinID:  XP_009070874 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search PGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVG LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA NT seq 283 nt NT seq  +upstreamnt  +downstreamnt gccggggaccgtggccctccgtgaaatccggcgctatcaaaagtctaccgaacttttgat ccgcaaactccccttccagcgtctggtgcgtgaaattgctcaggacttcaagacagatct gcgctttcagagcgctgccatcggtgctttgcaggaggcaagtgaagcctacttggttgg cctgtttgaagataccaacctgtgtgctatccatgccaaacgtgtcacaatcatgccaaa agatatccagctagcacgccgcatacgtggagagcgtgcctaa

DBGET integrated database retrieval system