Acanthisitta chloris (rifleman): 103802110 Help Entry 103802110         CDS       T08456                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism achl  Acanthisitta chloris (rifleman) Pathway achl04621   NOD-like receptor signaling pathway achl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:achl00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103802110 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103802110 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:achl03110]     103802110 (TXN) Chaperones and folding catalysts [BR:achl03110]  Protein folding catalysts   Protein disulfide isomerase    103802110 (TXN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 AhpC-TSA OST3_OST6 Glutaredoxin DIM1 Thioredoxin_7 Thioredoxin_9 Redoxin Motif Other DBs NCBI-GeneID:  103802110 NCBI-ProteinID:  XP_009072814 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search TEFETELKSAGEKLIVVDFSATWCGPCKMIKPFFHSLSEKYGNVVFIEIDVDDAQDVASH CDVKCMPTFQFYKNGKKVQEFSGANKEKLEETIKSLV NT seq 294 nt NT seq  +upstreamnt  +downstreamnt accgaatttgagacagaactgaaatctgctggtgagaagcttatagtagttgatttttct gccacatggtgtggaccatgcaaaatgatcaagcccttcttccacagtttgtctgagaag tatggtaatgtggtgttcattgaaattgatgtggatgatgcccaggatgttgcttcccac tgcgatgtgaagtgcatgccaacgttccagttctacaagaatggaaagaaggtgcaggag ttctctggggccaataaagagaagctggaagagaccattaaaagtttagtctaa

DBGET integrated database retrieval system