Acanthisitta chloris (rifleman): 103802297 Help Entry 103802297         CDS       T08456                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism achl  Acanthisitta chloris (rifleman) Pathway achl04010   MAPK signaling pathway achl04068   FoxO signaling pathway achl04081   Hormone signaling achl04114   Oocyte meiosis achl04140   Autophagy - animal achl04150   mTOR signaling pathway achl04810   Regulation of actin cytoskeleton achl04910   Insulin signaling pathway achl04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:achl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103802297 (INS)    04068 FoxO signaling pathway     103802297 (INS)    04150 mTOR signaling pathway     103802297 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     103802297 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103802297 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     103802297 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103802297 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     103802297 (INS)    04914 Progesterone-mediated oocyte maturation     103802297 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:achl04052]     103802297 (INS) Cytokines and neuropeptides [BR:achl04052]  Neuropeptides   Unclassified    103802297 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  103802297 NCBI-ProteinID:  XP_009073003 UniProt:  A0A091MS75 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MALWIRSLPLLALLALSGLRTSHAAANQHLCGSHLVEALYLVCGERGFFYPKERRDVEQP LVSSPLHGEVRELPFQQEEFEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccgatcgctgcctcttctggcccttcttgctctttctggactgagg accagccatgcagctgccaaccagcacctctgtggctcccacttggtggaggctctctac ctggtgtgtggagagcggggtttcttctaccccaaagagcgacgggatgtggagcagcct ctagtgagcagtcccttgcatggtgaggtgagagagctgcccttccagcaggaggagttt gagaaagtgaagcgagggatcgttgagcaatgctgccacaacacatgctccctctaccaa ctggaaaactactgcaactag

DBGET integrated database retrieval system