Acanthisitta chloris (rifleman): 103802342 Help Entry 103802342         CDS       T08456                                  Symbol FGF16 Name (RefSeq) fibroblast growth factor 16   KO K04358   fibroblast growth factor Organism achl  Acanthisitta chloris (rifleman) Pathway achl04010   MAPK signaling pathway achl04020   Calcium signaling pathway achl04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:achl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103802342 (FGF16)    04020 Calcium signaling pathway     103802342 (FGF16)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103802342 (FGF16)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:achl04052]     103802342 (FGF16)    00536 Glycosaminoglycan binding proteins [BR:achl00536]     103802342 (FGF16) Cytokines and neuropeptides [BR:achl04052]  Cytokines   Growth factors (RTK binding)    103802342 (FGF16) Glycosaminoglycan binding proteins [BR:achl00536]  Heparan sulfate / Heparin   Growth factors/receptors    103802342 (FGF16) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  103802342 NCBI-ProteinID:  XP_009073051 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search NGTVQGTRQDHSRFGILEFISLAVGLVSIRGVDSGLYLGMNERGELYGSKKLTRECVFRE QFEENWYNTYASTLYKHPDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPAKIP AMYRDLFHYR NT seq 393 nt NT seq  +upstreamnt  +downstreamnt aacggcaccgttcagggcacccggcaggaccacagccgcttcgggattttggagtttatt agcctggcagtggggctggtgagcatccgtggggtggactctggactctacctcggcatg aatgagaggggcgagctgtatgggtcgaagaagctgacacgggagtgcgttttccgggag cagtttgaggagaactggtacaacacgtatgcctcgaccctgtacaagcacccggactcg gagcggcaatactatgtggctctgaacaaggatggctctccccgcgagggctacaggact aagagacaccagaagttcactcattttctaccccggcctgtggaccctgccaaaatccct gccatgtacagagacctcttccactacaggtga

DBGET integrated database retrieval system