KEGG Orthology (KO) [BR:achl00001]
09140 Cellular Processes
09141 Transport and catabolism
04144 Endocytosis
103802352 (CHMP4C)
09143 Cell growth and death
04217 Necroptosis
103802352 (CHMP4C)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:achl04131]
103802352 (CHMP4C)
03400 DNA repair and recombination proteins [BR:achl03400]
103802352 (CHMP4C)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:achl04147]
103802352 (CHMP4C)
Membrane trafficking [BR:achl04131]
Endosome - Lysosome transport
Endosomal sorting complexes required for transport (ESCRT)
ESCRT-III complex
103802352 (CHMP4C)
DNA repair and recombination proteins [BR:achl03400]
Eukaryotic type
Check point factors
Other check point factors
103802352 (CHMP4C)
Exosome [BR:achl04147]
Exosomal proteins
Exosomal proteins of other body fluids (saliva and urine)
103802352 (CHMP4C)
Exosomal proteins of colorectal cancer cells
103802352 (CHMP4C)
154 aa
ALQALKRKKRYEKQLSQIDGTLSTIEFQREALENSHTNTEVLKNMGYAAQAMKKVHQNMD
LNKIDDLMQDITEQQDVAQEISDAISNRATFGDEFDEDELMAELEELEQEELNKGMRDVR
LPSVPSTSLPSGPASTRRRAEDEDEMKQLAAWAS