Acanthisitta chloris (rifleman): 103802570 Help Entry 103802570         CDS       T08456                                  Symbol ARF6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism achl  Acanthisitta chloris (rifleman) Pathway achl04144   Endocytosis achl04517   IgSF CAM signaling achl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:achl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     103802570 (ARF6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103802570 (ARF6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103802570 (ARF6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:achl04131]     103802570 (ARF6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:achl04147]     103802570 (ARF6)    04031 GTP-binding proteins [BR:achl04031]     103802570 (ARF6) Membrane trafficking [BR:achl04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     103802570 (ARF6)   Arf GTPases and associated proteins    Arf GTPases     103802570 (ARF6) Exosome [BR:achl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103802570 (ARF6)   Exosomal proteins of colorectal cancer cells    103802570 (ARF6) GTP-binding proteins [BR:achl04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     103802570 (ARF6) SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc Ras G-alpha SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU SpoOE-like 6PF2K CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  103802570 NCBI-ProteinID:  XP_009073302 LinkDB All DBs Position Unknown AA seq 162 aa AA seqDB search MRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPL WRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPH EIQEKLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSNYKS NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgcggatcctgatgctgggtctggacgcggccggtaagacgacgatcctgtacaaactg aagctgggccagtcggtgaccacgatccccacggtggggttcaacgtggagacggtgact tacaaaaacgtcaagttcaacgtgtgggatgtggggggtcaggacaagatccgaccgctc tggaggcactactacacgggcacgcaagggctcatcttcgtggtggactgcgccgaccgc gaccgcatcgacgaggcgcggcaggagctgcaccgcatcatcaacgaccgggagatgcgg gacgccatcatcctcatcttcgccaacaagcaggacctgcccgatgccatgaaaccccat gaaatccaggagaaactgggcctgacccggatcagggataggaattggtatgtgcagccc tcctgtgccacgacaggggatggactctacgaagggctgacgtggttaacatccaattat aaatcctaa

DBGET integrated database retrieval system