Acanthisitta chloris (rifleman): 103804602 Help Entry 103804602         CDS       T08456                                  Symbol PFN3 Name (RefSeq) LOW QUALITY PROTEIN: profilin-3   KO K05759   profilin Organism achl  Acanthisitta chloris (rifleman) Pathway achl04810   Regulation of actin cytoskeleton achl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:achl00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103804602 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103804602 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:achl04131]     103804602 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:achl04812]     103804602 (PFN3)    04147 Exosome [BR:achl04147]     103804602 (PFN3) Membrane trafficking [BR:achl04131]  Others   Actin-binding proteins    Others     103804602 (PFN3) Cytoskeleton proteins [BR:achl04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      103804602 (PFN3) Exosome [BR:achl04147]  Exosomal proteins   Proteins found in most exosomes    103804602 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  103804602 NCBI-ProteinID:  XP_009075466 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search LSGKWAIKPGRLLTAILPQELGLITGHDRKTFLLTGITIAGKKCSVICDNLLVDXDNVMG VRSKATDNRYIIIGKTPKILIFLMGKKGVHGGDLNQNNQDMTGGMKA NT seq 326 nt NT seq  +upstreamnt  +downstreamnt gcctctctggcaagtgggcaatcaaaccaggaaggctcctcacagccatcttgcctcaag aattaggcttgatcacaggccatgatcggaaaacgttcctgctaacaggaatcaccatag ctggaaaaaagtgcagcgtgatttgtgacaacctgctagtggatnaagacaatgtgatgg gtgtcagaagcaaagcaactgacaacagatacatcattattggcaagacacccaaaatct tgatcttcctcatgggcaagaagggagttcatggaggagacctcaaccaaaacaaccagg atatgactgggggcatgaaagcatga

DBGET integrated database retrieval system