Acanthisitta chloris (rifleman): 103807865 Help Entry 103807865         CDS       T08456                                  Symbol MLN Name (RefSeq) promotilin   KO K05265   motilin Organism achl  Acanthisitta chloris (rifleman) Pathway achl04080   Neuroactive ligand-receptor interaction achl04081   Hormone signaling Brite KEGG Orthology (KO) [BR:achl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     103807865 (MLN)    04081 Hormone signaling     103807865 (MLN)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:achl04052]     103807865 (MLN) Cytokines and neuropeptides [BR:achl04052]  Neuropeptides   GPCR binding    103807865 (MLN) SSDB OrthologParalogGFIT Motif Pfam:  Motilin_ghrelin PP28 Antimicrobial12 MPN_499 Motif Other DBs NCBI-GeneID:  103807865 NCBI-ProteinID:  XP_009078865 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search MLSRKVVASLLLVYMVSLLAEQTEGFMPFFTHSDFQKMQEKERHKGGQKKSLSSLQQLDE EGSSEQSRADVNRVKTIQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgctttcaaggaaggtggtggccagtttgctcctggtctacatggtgtctctgctggct gaacagaccgaaggcttcatgcccttcttcacccacagtgacttccagaaaatgcaggaa aaggagcggcacaagggagggcagaagaagtccctgagctcactgcagcagctggatgag gaaggatcctctgagcaatccagggcagatgtcaacagggtcaagaccatccag

DBGET integrated database retrieval system