Acanthisitta chloris (rifleman): 103808837 Help Entry 103808837         CDS       T08456                                  Name (RefSeq) C-C motif chemokine 4-like   KO K12964   C-C motif chemokine 4 Organism achl  Acanthisitta chloris (rifleman) Pathway achl04060   Cytokine-cytokine receptor interaction achl04620   Toll-like receptor signaling pathway achl04623   Cytosolic DNA-sensing pathway Brite KEGG Orthology (KO) [BR:achl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103808837  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103808837    04623 Cytosolic DNA-sensing pathway     103808837  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:achl04052]     103808837 Cytokines and neuropeptides [BR:achl04052]  Cytokines   Chemokines    103808837 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  103808837 NCBI-ProteinID:  XP_009079891 UniProt:  A0A091NF07 LinkDB All DBs Position Unknown AA seq 90 aa AA seqDB search MKVSAALLGLLLLAASFSQTLCGPDGSNRPVCCFSYTQHKLPQNLILRHYSTSTSCPKAA IVFITKKGRQVCANPSDTWVQSYLQSLKQN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctctgcagcccttttgggtcttctcctccttgcagcctccttctcccagact ctctgtggcccagatggatctaaccgcccagtctgctgcttctcctacacacagcacaag cttccccagaatctcatcctccgtcactacagcaccagcaccagctgccccaaggctgcc attgtgttcatcacaaagaaaggccgtcaggtctgtgccaaccccagtgacacctgggtc cagagctacctgcaaagcttgaagcagaactga

DBGET integrated database retrieval system