Acanthisitta chloris (rifleman): 103809637 Help Entry 103809637         CDS       T08456                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism achl  Acanthisitta chloris (rifleman) Pathway achl04140   Autophagy - animal achl04144   Endocytosis achl04530   Tight junction Brite KEGG Orthology (KO) [BR:achl00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103809637 (RAB8A)    04140 Autophagy - animal     103809637 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     103809637 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:achl04131]     103809637 (RAB8A)    03036 Chromosome and associated proteins [BR:achl03036]     103809637 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:achl04147]     103809637 (RAB8A)    04031 GTP-binding proteins [BR:achl04031]     103809637 (RAB8A) Membrane trafficking [BR:achl04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     103809637 (RAB8A)  Autophagy   Other autophagy associated proteins     103809637 (RAB8A) Chromosome and associated proteins [BR:achl03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     103809637 (RAB8A) Exosome [BR:achl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103809637 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    103809637 (RAB8A)   Exosomal proteins of colorectal cancer cells    103809637 (RAB8A) GTP-binding proteins [BR:achl04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     103809637 (RAB8A) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA DUF3963 Motif Other DBs NCBI-GeneID:  103809637 NCBI-ProteinID:  XP_009080744 LinkDB All DBs Position Unknown AA seq 165 aa AA seqDB search IDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIRNW VRNIEEHASPDVEKMILGNKCDANDKRQVSREQGEKLAASFGIKFMETSAKANINIENAF FTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKKSSFFRCVLL NT seq 500 nt NT seq  +upstreamnt  +downstreamnt gtattgattttaaaataaggacgatagagctcgatgggaagaggatcaagctgcagatct gggacacggctgggcaggagcgattcaggaccatcaccactgcctactacaggggagcca tgggcatcatgttggtgtatgacatcaccaacgaaaagtcttttgaaaacattcggaact gggtcaggaatattgaagagcacgcctctccagacgtggaaaaaatgatcctggggaaca aatgcgatgcaaacgacaaaagacaagtttctagagagcagggggagaagcttgctgcaa gttttgggattaaatttatggagaccagtgcaaaagcaaatataaacatagagaatgcat ttttcactcttgcaagagatatcaaagcaaaaatggacaagaagttggaaggcaatagcc cacaaggcagcaaccagggagtcaaaatcacaccagaccagcaaaagaaaagcagctttt tccgatgtgttcttctgtga

DBGET integrated database retrieval system