Acanthisitta chloris (rifleman): 103811226 Help Entry 103811226         CDS       T08456                                  Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism achl  Acanthisitta chloris (rifleman) Pathway achl04010   MAPK signaling pathway achl04012   ErbB signaling pathway achl04068   FoxO signaling pathway achl04137   Mitophagy - animal achl04140   Autophagy - animal achl04150   mTOR signaling pathway achl04210   Apoptosis achl04218   Cellular senescence achl04370   VEGF signaling pathway achl04371   Apelin signaling pathway achl04540   Gap junction achl04625   C-type lectin receptor signaling pathway achl04810   Regulation of actin cytoskeleton achl04910   Insulin signaling pathway achl04912   GnRH signaling pathway achl04916   Melanogenesis Brite KEGG Orthology (KO) [BR:achl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103811226    04012 ErbB signaling pathway     103811226    04370 VEGF signaling pathway     103811226    04371 Apelin signaling pathway     103811226    04068 FoxO signaling pathway     103811226    04150 mTOR signaling pathway     103811226  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103811226    04137 Mitophagy - animal     103811226   09143 Cell growth and death    04210 Apoptosis     103811226    04218 Cellular senescence     103811226   09144 Cellular community - eukaryotes    04540 Gap junction     103811226   09142 Cell motility    04810 Regulation of actin cytoskeleton     103811226  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103811226   09152 Endocrine system    04910 Insulin signaling pathway     103811226    04912 GnRH signaling pathway     103811226    04916 Melanogenesis     103811226  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:achl04131]     103811226   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:achl04147]     103811226    04031 GTP-binding proteins [BR:achl04031]     103811226 Membrane trafficking [BR:achl04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     103811226  Endocytosis   Macropinocytosis    Ras GTPases     103811226 Exosome [BR:achl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103811226   Exosomal proteins of other body fluids (saliva and urine)    103811226   Exosomal proteins of breast cancer cells    103811226   Exosomal proteins of colorectal cancer cells    103811226 GTP-binding proteins [BR:achl04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103811226 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf FeoB_N RsgA_GTPase MMR_HSR1 Motif Other DBs NCBI-GeneID:  103811226 NCBI-ProteinID:  XP_009082430 LinkDB All DBs Position Unknown AA seq 158 aa AA seqDB search DSYRKQDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFA DINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAQELAKSYGIPFIETSAKTRQG VEDAFYTLVREIRQYRMKKLNSSEDGNQGCMGLSCAVM NT seq 477 nt NT seq  +upstreamnt  +downstreamnt gactcgtaccgcaagcaggactcgtaccgcaagcaggtagtgatcgatggtgagacttgt ctgctggacatcctggacacagcagggcaggaggagtacagtgccatgagggaccagtac atgaggactggggagggattcctctgtgtctttgccattaacaacagcaaatccttcgct gatatcaacctttacagagaacagatcaagagagtgaaagattcggatgatgtgcccatg gtgctagttgggaacaagtgtgatctgcccacaagaacagtagacacaaaacaggcacaa gaactagcaaagagctatgggattcccttcatagagacctctgcaaaaacgagacagggt gtggaagatgctttttacacactggtgagagagatccgacagtaccggatgaaaaagctc aacagcagtgaggatgggaaccaaggctgcatgggattgtcctgtgctgtgatgtga

DBGET integrated database retrieval system