Acanthisitta chloris (rifleman): 103811614 Help Entry 103811614         CDS       T08456                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism achl  Acanthisitta chloris (rifleman) Brite KEGG Orthology (KO) [BR:achl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:achl03036]     103811614   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:achl04147]     103811614 Chromosome and associated proteins [BR:achl03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103811614 Exosome [BR:achl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103811614 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  103811614 NCBI-ProteinID:  XP_009082847 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKTQKKGDKKRKKSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDMPSMPQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccggccaagtccgcccccgcgcctaagaagggctccaagaaggcggttacc aagacccagaagaagggagacaagaagcgtaagaagagccgcaaggagagctactccatc tacgtgtacaaggtactgaagcaggtgcaccctgacactggcatctcgtccaaggccatg ggcatcatgaactccttcgtcaacgacatgccaagcatgccacaa

DBGET integrated database retrieval system